Manis javanica (Malayan pangolin): 108396195 Help Entry 108396195         CDS       T06054                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04024   cAMP signaling pathway mjv04080   Neuroactive ligand-receptor interaction mjv04920   Adipocytokine signaling pathway mjv04923   Regulation of lipolysis in adipocytes mjv05034   Alcoholism Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     108396195 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     108396195 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     108396195 (NPY)    04920 Adipocytokine signaling pathway     108396195 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     108396195 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108396195 (NPY) Cytokines and neuropeptides [BR:mjv04052]  Neuropeptides   Neuropeptides (GPCR binding)    108396195 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  108396195 NCBI-ProteinID:  XP_017514435 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagtaagcgactggggctgtcgggactgacccttgccctgtccctgcttgtg tgcctgggcgcgctggccgaggcgtacccctccaagccggacaatccgggagaggacgcg ccggcggaggacatggctagatactactcggcgctgcgacactacataaacctcatcacc aggcagagatacggaaaacgatctagccctgagacactgatttcagaccttttgatgaga gaaagcacagaaaacgttcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system