Manis javanica (Malayan pangolin): 108397867 Help Entry 108397867         CDS       T06054                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv03008   Ribosome biogenesis in eukaryotes mjv03083   Polycomb repressive complex mjv04064   NF-kappa B signaling pathway mjv04137   Mitophagy - animal mjv04310   Wnt signaling pathway mjv04520   Adherens junction mjv05010   Alzheimer disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05162   Measles mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     108397867 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     108397867 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108397867 (CSNK2B)    04064 NF-kappa B signaling pathway     108397867 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     108397867 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     108397867 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108397867 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     108397867 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     108397867 (CSNK2B)    05020 Prion disease     108397867 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     108397867 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mjv03009]     108397867 (CSNK2B)    03036 Chromosome and associated proteins [BR:mjv03036]     108397867 (CSNK2B) Ribosome biogenesis [BR:mjv03009]  Eukaryotic type   90S particles    Kinase     108397867 (CSNK2B) Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      108397867 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  108397867 NCBI-ProteinID:  XP_017516970 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcatggttctgtgggctccgaggcaatgaa ttcttctgtgaggtggatgaagactatatccaggataaattcaatctcactggactcaat gaacaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgaacaggcagctgagatgctttat ggattgatccacgcccgctatatccttaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtcctcgtgtgtactgtgagaaccagccaatgctc cccatcggcctttcagacatcccaggcgaggccatggtgaagctgtactgccccaagtgc atggacgtgtacacacccaagtcatcaagacaccaccacacggacggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtatcggcccaagcggcctgcc aaccagtttgtgcccaggctctatggtttcaagatccatccgatggcctaccagctgcag ctacaagccgccagcaacttcaagagcccagtcaagacaattcgctga

DBGET integrated database retrieval system