Manis javanica (Malayan pangolin): 108398047 Help Entry 108398047         CDS       T06054                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04012   ErbB signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04062   Chemokine signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04072   Phospholipase D signaling pathway mjv04137   Mitophagy - animal mjv04140   Autophagy - animal mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04211   Longevity regulating pathway mjv04213   Longevity regulating pathway - multiple species mjv04218   Cellular senescence mjv04360   Axon guidance mjv04370   VEGF signaling pathway mjv04371   Apelin signaling pathway mjv04540   Gap junction mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04625   C-type lectin receptor signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04714   Thermogenesis mjv04720   Long-term potentiation mjv04722   Neurotrophin signaling pathway mjv04725   Cholinergic synapse mjv04726   Serotonergic synapse mjv04730   Long-term depression mjv04810   Regulation of actin cytoskeleton mjv04910   Insulin signaling pathway mjv04912   GnRH signaling pathway mjv04915   Estrogen signaling pathway mjv04916   Melanogenesis mjv04917   Prolactin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04929   GnRH secretion mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05010   Alzheimer disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05034   Alcoholism mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05210   Colorectal cancer mjv05211   Renal cell carcinoma mjv05213   Endometrial cancer mjv05214   Glioma mjv05215   Prostate cancer mjv05216   Thyroid cancer mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05221   Acute myeloid leukemia mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05230   Central carbon metabolism in cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     108398047 (NRAS)    04015 Rap1 signaling pathway     108398047 (NRAS)    04068 FoxO signaling pathway     108398047 (NRAS)    04072 Phospholipase D signaling pathway     108398047 (NRAS)    04071 Sphingolipid signaling pathway     108398047 (NRAS)    04151 PI3K-Akt signaling pathway     108398047 (NRAS)    04150 mTOR signaling pathway     108398047 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108398047 (NRAS)    04137 Mitophagy - animal     108398047 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     108398047 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     108398047 (NRAS)    04660 T cell receptor signaling pathway     108398047 (NRAS)    04662 B cell receptor signaling pathway     108398047 (NRAS)    04664 Fc epsilon RI signaling pathway     108398047 (NRAS)    04062 Chemokine signaling pathway     108398047 (NRAS)   09152 Endocrine system    04929 GnRH secretion     108398047 (NRAS)    04915 Estrogen signaling pathway     108398047 (NRAS)    04917 Prolactin signaling pathway     108398047 (NRAS)    04921 Oxytocin signaling pathway     108398047 (NRAS)    04926 Relaxin signaling pathway     108398047 (NRAS)    04935 Growth hormone synthesis, secretion and action     108398047 (NRAS)    04919 Thyroid hormone signaling pathway     108398047 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     108398047 (NRAS)    04726 Serotonergic synapse     108398047 (NRAS)    04720 Long-term potentiation     108398047 (NRAS)    04730 Long-term depression     108398047 (NRAS)    04722 Neurotrophin signaling pathway     108398047 (NRAS)   09158 Development and regeneration    04360 Axon guidance     108398047 (NRAS)   09149 Aging    04211 Longevity regulating pathway     108398047 (NRAS)    04213 Longevity regulating pathway - multiple species     108398047 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     108398047 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108398047 (NRAS)    05206 MicroRNAs in cancer     108398047 (NRAS)    05205 Proteoglycans in cancer     108398047 (NRAS)    05207 Chemical carcinogenesis - receptor activation     108398047 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     108398047 (NRAS)    05203 Viral carcinogenesis     108398047 (NRAS)    05230 Central carbon metabolism in cancer     108398047 (NRAS)    05231 Choline metabolism in cancer     108398047 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108398047 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     108398047 (NRAS)    05225 Hepatocellular carcinoma     108398047 (NRAS)    05226 Gastric cancer     108398047 (NRAS)    05214 Glioma     108398047 (NRAS)    05216 Thyroid cancer     108398047 (NRAS)    05221 Acute myeloid leukemia     108398047 (NRAS)    05220 Chronic myeloid leukemia     108398047 (NRAS)    05218 Melanoma     108398047 (NRAS)    05211 Renal cell carcinoma     108398047 (NRAS)    05219 Bladder cancer     108398047 (NRAS)    05215 Prostate cancer     108398047 (NRAS)    05213 Endometrial cancer     108398047 (NRAS)    05224 Breast cancer     108398047 (NRAS)    05223 Non-small cell lung cancer     108398047 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108398047 (NRAS)    05170 Human immunodeficiency virus 1 infection     108398047 (NRAS)    05161 Hepatitis B     108398047 (NRAS)    05160 Hepatitis C     108398047 (NRAS)    05163 Human cytomegalovirus infection     108398047 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     108398047 (NRAS)    05165 Human papillomavirus infection     108398047 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     108398047 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     108398047 (NRAS)   09165 Substance dependence    05034 Alcoholism     108398047 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108398047 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     108398047 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     108398047 (NRAS)    01522 Endocrine resistance     108398047 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108398047 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108398047 (NRAS)    04031 GTP-binding proteins [BR:mjv04031]     108398047 (NRAS) Membrane trafficking [BR:mjv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     108398047 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     108398047 (NRAS) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108398047 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    108398047 (NRAS)   Exosomal proteins of breast cancer cells    108398047 (NRAS)   Exosomal proteins of colorectal cancer cells    108398047 (NRAS) GTP-binding proteins [BR:mjv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108398047 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  108398047 NCBI-ProteinID:  XP_017517293 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttggaaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtcgttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctttacagggaacagatt aaacgagtaaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattccg ttcattgaaacctcagccaagacgagacagggtgttgaagatgccttttacacactggta agagaaatccgtcagtatcgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system