KEGG   Manis javanica (Malayan pangolin): 108398454
Entry
108398454         CDS       T06054                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mjv  Manis javanica (Malayan pangolin)
Pathway
mjv01521  EGFR tyrosine kinase inhibitor resistance
mjv01522  Endocrine resistance
mjv01524  Platinum drug resistance
mjv04010  MAPK signaling pathway
mjv04012  ErbB signaling pathway
mjv04014  Ras signaling pathway
mjv04015  Rap1 signaling pathway
mjv04022  cGMP-PKG signaling pathway
mjv04024  cAMP signaling pathway
mjv04062  Chemokine signaling pathway
mjv04066  HIF-1 signaling pathway
mjv04068  FoxO signaling pathway
mjv04071  Sphingolipid signaling pathway
mjv04072  Phospholipase D signaling pathway
mjv04114  Oocyte meiosis
mjv04140  Autophagy - animal
mjv04148  Efferocytosis
mjv04150  mTOR signaling pathway
mjv04151  PI3K-Akt signaling pathway
mjv04210  Apoptosis
mjv04218  Cellular senescence
mjv04261  Adrenergic signaling in cardiomyocytes
mjv04270  Vascular smooth muscle contraction
mjv04350  TGF-beta signaling pathway
mjv04360  Axon guidance
mjv04370  VEGF signaling pathway
mjv04371  Apelin signaling pathway
mjv04380  Osteoclast differentiation
mjv04510  Focal adhesion
mjv04520  Adherens junction
mjv04540  Gap junction
mjv04550  Signaling pathways regulating pluripotency of stem cells
mjv04611  Platelet activation
mjv04613  Neutrophil extracellular trap formation
mjv04620  Toll-like receptor signaling pathway
mjv04621  NOD-like receptor signaling pathway
mjv04625  C-type lectin receptor signaling pathway
mjv04650  Natural killer cell mediated cytotoxicity
mjv04657  IL-17 signaling pathway
mjv04658  Th1 and Th2 cell differentiation
mjv04659  Th17 cell differentiation
mjv04660  T cell receptor signaling pathway
mjv04662  B cell receptor signaling pathway
mjv04664  Fc epsilon RI signaling pathway
mjv04666  Fc gamma R-mediated phagocytosis
mjv04668  TNF signaling pathway
mjv04713  Circadian entrainment
mjv04720  Long-term potentiation
mjv04722  Neurotrophin signaling pathway
mjv04723  Retrograde endocannabinoid signaling
mjv04724  Glutamatergic synapse
mjv04725  Cholinergic synapse
mjv04726  Serotonergic synapse
mjv04730  Long-term depression
mjv04810  Regulation of actin cytoskeleton
mjv04910  Insulin signaling pathway
mjv04912  GnRH signaling pathway
mjv04914  Progesterone-mediated oocyte maturation
mjv04915  Estrogen signaling pathway
mjv04916  Melanogenesis
mjv04917  Prolactin signaling pathway
mjv04919  Thyroid hormone signaling pathway
mjv04921  Oxytocin signaling pathway
mjv04926  Relaxin signaling pathway
mjv04928  Parathyroid hormone synthesis, secretion and action
mjv04929  GnRH secretion
mjv04930  Type II diabetes mellitus
mjv04933  AGE-RAGE signaling pathway in diabetic complications
mjv04934  Cushing syndrome
mjv04935  Growth hormone synthesis, secretion and action
mjv04960  Aldosterone-regulated sodium reabsorption
mjv05010  Alzheimer disease
mjv05020  Prion disease
mjv05022  Pathways of neurodegeneration - multiple diseases
mjv05034  Alcoholism
mjv05132  Salmonella infection
mjv05133  Pertussis
mjv05135  Yersinia infection
mjv05140  Leishmaniasis
mjv05142  Chagas disease
mjv05145  Toxoplasmosis
mjv05152  Tuberculosis
mjv05160  Hepatitis C
mjv05161  Hepatitis B
mjv05163  Human cytomegalovirus infection
mjv05164  Influenza A
mjv05165  Human papillomavirus infection
mjv05166  Human T-cell leukemia virus 1 infection
mjv05167  Kaposi sarcoma-associated herpesvirus infection
mjv05170  Human immunodeficiency virus 1 infection
mjv05171  Coronavirus disease - COVID-19
mjv05200  Pathways in cancer
mjv05203  Viral carcinogenesis
mjv05205  Proteoglycans in cancer
mjv05206  MicroRNAs in cancer
mjv05207  Chemical carcinogenesis - receptor activation
mjv05208  Chemical carcinogenesis - reactive oxygen species
mjv05210  Colorectal cancer
mjv05211  Renal cell carcinoma
mjv05212  Pancreatic cancer
mjv05213  Endometrial cancer
mjv05214  Glioma
mjv05215  Prostate cancer
mjv05216  Thyroid cancer
mjv05218  Melanoma
mjv05219  Bladder cancer
mjv05220  Chronic myeloid leukemia
mjv05221  Acute myeloid leukemia
mjv05223  Non-small cell lung cancer
mjv05224  Breast cancer
mjv05225  Hepatocellular carcinoma
mjv05226  Gastric cancer
mjv05230  Central carbon metabolism in cancer
mjv05231  Choline metabolism in cancer
mjv05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mjv05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mjv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108398454 (MAPK3)
   04012 ErbB signaling pathway
    108398454 (MAPK3)
   04014 Ras signaling pathway
    108398454 (MAPK3)
   04015 Rap1 signaling pathway
    108398454 (MAPK3)
   04350 TGF-beta signaling pathway
    108398454 (MAPK3)
   04370 VEGF signaling pathway
    108398454 (MAPK3)
   04371 Apelin signaling pathway
    108398454 (MAPK3)
   04668 TNF signaling pathway
    108398454 (MAPK3)
   04066 HIF-1 signaling pathway
    108398454 (MAPK3)
   04068 FoxO signaling pathway
    108398454 (MAPK3)
   04072 Phospholipase D signaling pathway
    108398454 (MAPK3)
   04071 Sphingolipid signaling pathway
    108398454 (MAPK3)
   04024 cAMP signaling pathway
    108398454 (MAPK3)
   04022 cGMP-PKG signaling pathway
    108398454 (MAPK3)
   04151 PI3K-Akt signaling pathway
    108398454 (MAPK3)
   04150 mTOR signaling pathway
    108398454 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108398454 (MAPK3)
   04148 Efferocytosis
    108398454 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108398454 (MAPK3)
   04210 Apoptosis
    108398454 (MAPK3)
   04218 Cellular senescence
    108398454 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108398454 (MAPK3)
   04520 Adherens junction
    108398454 (MAPK3)
   04540 Gap junction
    108398454 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    108398454 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108398454 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108398454 (MAPK3)
   04613 Neutrophil extracellular trap formation
    108398454 (MAPK3)
   04620 Toll-like receptor signaling pathway
    108398454 (MAPK3)
   04621 NOD-like receptor signaling pathway
    108398454 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    108398454 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    108398454 (MAPK3)
   04660 T cell receptor signaling pathway
    108398454 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    108398454 (MAPK3)
   04659 Th17 cell differentiation
    108398454 (MAPK3)
   04657 IL-17 signaling pathway
    108398454 (MAPK3)
   04662 B cell receptor signaling pathway
    108398454 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    108398454 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    108398454 (MAPK3)
   04062 Chemokine signaling pathway
    108398454 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108398454 (MAPK3)
   04929 GnRH secretion
    108398454 (MAPK3)
   04912 GnRH signaling pathway
    108398454 (MAPK3)
   04915 Estrogen signaling pathway
    108398454 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    108398454 (MAPK3)
   04917 Prolactin signaling pathway
    108398454 (MAPK3)
   04921 Oxytocin signaling pathway
    108398454 (MAPK3)
   04926 Relaxin signaling pathway
    108398454 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    108398454 (MAPK3)
   04919 Thyroid hormone signaling pathway
    108398454 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    108398454 (MAPK3)
   04916 Melanogenesis
    108398454 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108398454 (MAPK3)
   04270 Vascular smooth muscle contraction
    108398454 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108398454 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    108398454 (MAPK3)
   04725 Cholinergic synapse
    108398454 (MAPK3)
   04726 Serotonergic synapse
    108398454 (MAPK3)
   04720 Long-term potentiation
    108398454 (MAPK3)
   04730 Long-term depression
    108398454 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    108398454 (MAPK3)
   04722 Neurotrophin signaling pathway
    108398454 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    108398454 (MAPK3)
   04380 Osteoclast differentiation
    108398454 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    108398454 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108398454 (MAPK3)
   05206 MicroRNAs in cancer
    108398454 (MAPK3)
   05205 Proteoglycans in cancer
    108398454 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    108398454 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    108398454 (MAPK3)
   05203 Viral carcinogenesis
    108398454 (MAPK3)
   05230 Central carbon metabolism in cancer
    108398454 (MAPK3)
   05231 Choline metabolism in cancer
    108398454 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108398454 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108398454 (MAPK3)
   05212 Pancreatic cancer
    108398454 (MAPK3)
   05225 Hepatocellular carcinoma
    108398454 (MAPK3)
   05226 Gastric cancer
    108398454 (MAPK3)
   05214 Glioma
    108398454 (MAPK3)
   05216 Thyroid cancer
    108398454 (MAPK3)
   05221 Acute myeloid leukemia
    108398454 (MAPK3)
   05220 Chronic myeloid leukemia
    108398454 (MAPK3)
   05218 Melanoma
    108398454 (MAPK3)
   05211 Renal cell carcinoma
    108398454 (MAPK3)
   05219 Bladder cancer
    108398454 (MAPK3)
   05215 Prostate cancer
    108398454 (MAPK3)
   05213 Endometrial cancer
    108398454 (MAPK3)
   05224 Breast cancer
    108398454 (MAPK3)
   05223 Non-small cell lung cancer
    108398454 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108398454 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    108398454 (MAPK3)
   05161 Hepatitis B
    108398454 (MAPK3)
   05160 Hepatitis C
    108398454 (MAPK3)
   05171 Coronavirus disease - COVID-19
    108398454 (MAPK3)
   05164 Influenza A
    108398454 (MAPK3)
   05163 Human cytomegalovirus infection
    108398454 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108398454 (MAPK3)
   05165 Human papillomavirus infection
    108398454 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108398454 (MAPK3)
   05135 Yersinia infection
    108398454 (MAPK3)
   05133 Pertussis
    108398454 (MAPK3)
   05152 Tuberculosis
    108398454 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108398454 (MAPK3)
   05140 Leishmaniasis
    108398454 (MAPK3)
   05142 Chagas disease
    108398454 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108398454 (MAPK3)
   05020 Prion disease
    108398454 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    108398454 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    108398454 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108398454 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108398454 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108398454 (MAPK3)
   04934 Cushing syndrome
    108398454 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108398454 (MAPK3)
   01524 Platinum drug resistance
    108398454 (MAPK3)
   01522 Endocrine resistance
    108398454 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mjv01001]
    108398454 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mjv03036]
    108398454 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mjv04147]
    108398454 (MAPK3)
Enzymes [BR:mjv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108398454 (MAPK3)
Protein kinases [BR:mjv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108398454 (MAPK3)
Chromosome and associated proteins [BR:mjv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     108398454 (MAPK3)
Exosome [BR:mjv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108398454 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 108398454
NCBI-ProteinID: XP_017517988
LinkDB
Position
Unknown
AA seq 377 aa
MAAVAAQGGGESRGADGVGPGVPGGVETVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDH
ACKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEVMRDVYIVQ
DLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKI
CDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNR
PIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLQSLPSKTKVAWTKLFPKSDSK
ALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKE
LIFQETARFQPGAPEAP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggcggtggcggctcaggggggcggggagtcccggggagctgatggggtcggccca
ggggtcccggggggagtggagacagtgaagggacagccgttcgacgtgggcccgcgctac
acgcagctccagtacatcggcgagggcgcttacggcatggtcagctcagcttatgaccat
gcgtgcaagattcgcgtggccatcaagaaaatcagcccctttgagcatcagacctactgc
cagcgcacactgcgggagatccagatcttgctgcgcttccgccatgagaacgttattggc
attcgagacattctgcgggcacccaccctggaagtcatgagggatgtctatattgtgcag
gacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaacgaccac
gtttgctacttcctctaccagatccttcggggcctcaagtatatccactcagccaatgtg
ctccaccgagatttaaagccctccaacttgctcatcaacaccacctgcgaccttaagatc
tgtgattttggcctggcccgaattgctgatcctgaacatgaccacactggcttcctgact
gagtatgtggccacacgctggtaccgtgccccagagatcatgcttaactccaagggctat
accaagtccattgacatctggtctgtgggctgcattctggctgagatgctctccaaccgg
cccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatcctgggc
tccccatcccaggaggacctgaattgtatcatcaacctgaaggcccgaaactacttacag
tctctgccttccaagaccaaggtggcctggaccaagctgtttcccaagtcagactccaaa
gcacttgacctgctggaccggatgttgacctttaaccccaacaaacggatcacagtggag
gaagctctggctcacccctacctggagcaatactacgacccaacggatgagccagtggct
gaggaacctttcaccttcgacatggagctggatgatctacccaaggagcggctgaaggag
ctcatcttccaggagacagcccgcttccagcctggggcaccggaggccccctaa

DBGET integrated database retrieval system