Manis javanica (Malayan pangolin): 108398581 Help Entry 108398581         CDS       T06054                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04146   Peroxisome mjv04213   Longevity regulating pathway - multiple species mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mjv00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     108398581 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     108398581 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     108398581 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     108398581 (SOD1)    05014 Amyotrophic lateral sclerosis     108398581 (SOD1)    05016 Huntington disease     108398581 (SOD1)    05020 Prion disease     108398581 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     108398581 (SOD1) Enzymes [BR:mjv01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      108398581 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  108398581 NCBI-ProteinID:  XP_017518157 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEKKAVCVLKGQGDVEGVIHFVQKGDGPVMVSGTIKGLTEGDHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAVVSMEDPMIALSGEHSVIGRTMVVH EKQDDLGRGGNEESTKTGNAGSRLACGVIGIAM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagaagaaggccgtgtgcgtgctgaagggccaaggcgatgtggagggcgtcatccac ttcgtgcagaagggagatgggccagtcatggtatcaggaaccattaaaggattgactgag ggcgatcatggattccacgtccatcaatttggagataatacacaaggctgtaccagtgca ggtcctcattttaatcctctgtccaaaaaacatggtgggccaaaggatcaagagaggcat gttggagacctgggcaatgtgactgctggcaaagatggtgtggctgttgtgtctatggaa gatcctatgattgccctctcaggagaacattccgtcattggccgcacaatggtggtccat gaaaagcaagatgacttgggcagaggtggaaatgaagagagtacaaaaacgggaaacgct ggaagtcgtttggcttgtggtgtaattgggatcgccatgtaa

DBGET integrated database retrieval system