Manis javanica (Malayan pangolin): 108398727 Help Entry 108398727         CDS       T06054                                  Name (RefSeq) C-X-C motif chemokine 15-like   KO K10030   interleukin 8 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04061   Viral protein interaction with cytokine and cytokine receptor mjv04062   Chemokine signaling pathway mjv04064   NF-kappa B signaling pathway mjv04072   Phospholipase D signaling pathway mjv04218   Cellular senescence mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04936   Alcoholic liver disease mjv05132   Salmonella infection mjv05133   Pertussis mjv05134   Legionellosis mjv05135   Yersinia infection mjv05142   Chagas disease mjv05144   Malaria mjv05146   Amoebiasis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05202   Transcriptional misregulation in cancer mjv05219   Bladder cancer mjv05323   Rheumatoid arthritis mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     108398727    04072 Phospholipase D signaling pathway     108398727   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108398727    04061 Viral protein interaction with cytokine and cytokine receptor     108398727  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     108398727  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108398727    04621 NOD-like receptor signaling pathway     108398727    04622 RIG-I-like receptor signaling pathway     108398727    04657 IL-17 signaling pathway     108398727    04062 Chemokine signaling pathway     108398727  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108398727    05202 Transcriptional misregulation in cancer     108398727   09162 Cancer: specific types    05219 Bladder cancer     108398727   09172 Infectious disease: viral    05161 Hepatitis B     108398727    05171 Coronavirus disease - COVID-19     108398727    05164 Influenza A     108398727    05163 Human cytomegalovirus infection     108398727    05167 Kaposi sarcoma-associated herpesvirus infection     108398727   09171 Infectious disease: bacterial    05132 Salmonella infection     108398727    05135 Yersinia infection     108398727    05133 Pertussis     108398727    05134 Legionellosis     108398727   09174 Infectious disease: parasitic    05146 Amoebiasis     108398727    05144 Malaria     108398727    05142 Chagas disease     108398727   09163 Immune disease    05323 Rheumatoid arthritis     108398727   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108398727   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108398727    04932 Non-alcoholic fatty liver disease     108398727    04933 AGE-RAGE signaling pathway in diabetic complications     108398727  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108398727    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108398727 Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Chemokines    108398727 Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Chemokines    108398727 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  108398727 NCBI-ProteinID:  XP_017518394 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MPAGSPRTFLLLVVFVLDIFADPCEGQELRCQCIQTYSEFISPKFITNVQLIPEGAYCSR KEVIVTLKDGKIVCLDPEADWVMTIIKKLINSN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcctgctgggagccctcgcacgttcctcctgctggtggtctttgtcctggacatcttt gctgatccctgtgagggccaagagttgcgatgtcagtgtatccagacatattctgagttt atttctcccaaattcattacaaatgtccagttaatacctgaaggtgcttactgcagcaga aaagaagtcattgtcacattgaaagatgggaaaatagtttgtttggatcctgaggctgac tgggtgatgactattatcaaaaagcttatcaacagtaactga

DBGET integrated database retrieval system