Manis javanica (Malayan pangolin): 108399324 Help Entry 108399324         CDS       T06054                                  Symbol CAV2 Name (RefSeq) caveolin-2 isoform X1   KO K12958   caveolin 2 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04144   Endocytosis mjv04510   Focal adhesion mjv05020   Prion disease mjv05100   Bacterial invasion of epithelial cells mjv05205   Proteoglycans in cancer mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108399324 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108399324 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108399324 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108399324 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     108399324 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108399324 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108399324 (CAV2) Membrane trafficking [BR:mjv04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     108399324 (CAV2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  108399324 NCBI-ProteinID:  XP_017519520 LinkDB All DBs Position 6:complement(32321013..32328344) Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDSYSRHSGVDYADPEKFADAGSDRDPHRLNSHLKVGFEDVIAEP VSSHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSMTDVVIAPLCTSIGRSFSSISLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgggactggagaccgagaaggcagacgtccagctcttcatggacgacgactcctacagc cgccacagcggcgtcgactacgccgaccccgagaagttcgcggacgcgggctcggatcgg gatccccaccggctcaactcgcatctcaaggtgggcttcgaggatgtgatcgcagagccc gtgtcctcgcactcctttgacaaagtgtggatttgcagccatgccctctttgaaatcagc aaatacgtgatctacaagttcctgacagtgttcctggccattcctctggccttcgctgcg gggattctctttgccaccctcagctgtctgcatatctggattttaatgccttttgtaaag acctgcctaatggtcctgccttcagtgcagacaatatggaagagcatgacagatgttgtc attgccccgttgtgtacaagcattggacgcagcttctcttctatcagcttgcagctgagc cacgactga

DBGET integrated database retrieval system