Manis javanica (Malayan pangolin): 108400171 Help Entry 108400171         CDS       T06054                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05203   Viral carcinogenesis mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108400171  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     108400171   09163 Immune disease    05322 Systemic lupus erythematosus     108400171   09165 Substance dependence    05034 Alcoholism     108400171  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108400171   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108400171 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108400171 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108400171 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone TFIID-31kDa CBFD_NFYB_HMF LonB_AAA-LID Motif Other DBs NCBI-GeneID:  108400171 NCBI-ProteinID:  XP_017520889 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MKSFVNDIFECIMGEASRVAHYNKRSTIISRDIQTAVRSLLSGELAKRAVSEGTKAVTKY TNSK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaagtcgttcgtcaacgacatcttcgagtgcatcatgggcgaggcgtcgcgcgtggcg cattacaataagcgctcgaccatcatctccagggacatccagacggccgtgcgctctctg ctgtccggggagctggccaagcgcgccgtgtccgagggcaccaaggccgtcaccaagtac accaactccaagtaa

DBGET integrated database retrieval system