Manis javanica (Malayan pangolin): 108400860 Help Entry 108400860         CDS       T06054                                  Symbol ELOC Name (RefSeq) elongin-C   KO K03872   elongin-C Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04066   HIF-1 signaling pathway mjv04120   Ubiquitin mediated proteolysis mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108400860 (ELOC)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     108400860 (ELOC)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108400860 (ELOC)   09162 Cancer: specific types    05211 Renal cell carcinoma     108400860 (ELOC)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     108400860 (ELOC)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mjv04121]     108400860 (ELOC)    03400 DNA repair and recombination proteins [BR:mjv03400]     108400860 (ELOC) Ubiquitin system [BR:mjv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108400860 (ELOC)    Cul5 complex      108400860 (ELOC) DNA repair and recombination proteins [BR:mjv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108400860 (ELOC) SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  108400860 NCBI-ProteinID:  XP_017521949 LinkDB All DBs Position 2:complement(161503640..161521194) Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggagaagaaaaaacctacggtggctgtgaaggcccagatgccatgtatgtcaag ttgatatcttcagatggtcatgaatttattgtaaaaagagaacatgcactaacatcggga acaataaaagccatgttgagtggcccaggtcagtttgctgagaatgaaactaatgaagtc aattttagagagatcccttcacatgtgctatcaaaagtatgcatgtattttacctacaag gttcgctacactaacagctccacagagattcctgaattcccaattgcacctgaaattgca ctggaactgctgatggctgcgaacttcctagattgttaa

DBGET integrated database retrieval system