Manis javanica (Malayan pangolin): 108401772 Help Entry 108401772         CDS       T06054                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04144   Endocytosis mjv04510   Focal adhesion mjv05020   Prion disease mjv05100   Bacterial invasion of epithelial cells mjv05205   Proteoglycans in cancer mjv05410   Hypertrophic cardiomyopathy mjv05412   Arrhythmogenic right ventricular cardiomyopathy mjv05414   Dilated cardiomyopathy mjv05416   Viral myocarditis mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108401772 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108401772 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     108401772 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108401772 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     108401772 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108401772 (CAV3)    05410 Hypertrophic cardiomyopathy     108401772 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     108401772 (CAV3)    05414 Dilated cardiomyopathy     108401772 (CAV3)    05416 Viral myocarditis     108401772 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     108401772 (CAV3) Membrane trafficking [BR:mjv04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     108401772 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  108401772 NCBI-ProteinID:  XP_017523407 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVLLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcacacagacctggaggcccagatcgtcaaggacattcactgcaag gagattgacctggtgaaccgagaccctaagaacattaacgaggacatagtgaaggtggat tttgaagatgtgatcgcggaacctgtgggcacctacagcttcgacggcgtgtggaaggtg agctacaccaccttcactgtctccaagtactggtgctaccgcctgctgtccacgctgctg ggcgtcccactggccttgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtaccgtgcattaagagttacctgattgagatccagtgcatcagccacatc tattcgctctgcatccgcaccttctgcaaccccctctttgccgccctgggccaggtctgc agcaacatcaaagtactgctgcggaaggaagtataa

DBGET integrated database retrieval system