Manis javanica (Malayan pangolin): 108402364 Help Entry 108402364         CDS       T06054                                  Symbol CTSB Name (RefSeq) cathepsin B isoform X2   KO K01363   cathepsin B [EC:3.4.22.1] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04140   Autophagy - animal mjv04142   Lysosome mjv04210   Apoptosis mjv04612   Antigen processing and presentation mjv04621   NOD-like receptor signaling pathway mjv04924   Renin secretion Brite KEGG Orthology (KO) [BR:mjv00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome     108402364 (CTSB)    04140 Autophagy - animal     108402364 (CTSB)   09143 Cell growth and death    04210 Apoptosis     108402364 (CTSB)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108402364 (CTSB)    04612 Antigen processing and presentation     108402364 (CTSB)   09152 Endocrine system    04924 Renin secretion     108402364 (CTSB)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:mjv01002]     108402364 (CTSB)   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mjv03110]     108402364 (CTSB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108402364 (CTSB)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108402364 (CTSB) Enzymes [BR:mjv01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.1  cathepsin B      108402364 (CTSB) Peptidases and inhibitors [BR:mjv01002]  Cysteine peptidases   Family C1: papain family    108402364 (CTSB) Chaperones and folding catalysts [BR:mjv03110]  Intramolecular chaperones   Papain family    108402364 (CTSB) Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of microglial cells    108402364 (CTSB) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Others    108402364 (CTSB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C1 Peptidase_C1_2 Motif Other DBs NCBI-GeneID:  108402364 NCBI-ProteinID:  XP_017524352 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MPGNSGRTARPSKRSETRAPAAPAGCNGGFPAAAWNFWTKKGLVSGGLYDSHIGCRPYSI PPCEHHVNGSRPSCTGEGDTPKCSKMCEPGYTPSYKEDKHYGCSSYSLSSSEKEIMAEIY KNGPVEAAFSVYSDFLLYKSGVYQHVTGDMMGGHAVRILGWGVEDGTPYWLVGNSWNTDW GDSGFFKILRGQDHCGIESEIVAGIPCADQY NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgcccgggaacagtggccgaactgcccgaccatcaaagagatccgagaccagggctcct gcggctcctgctggctgtaacgggggctttcctgctgcggcctggaacttctggacgaaa aagggcctggtttccgggggcctctacgactctcatataggctgcagaccctactccatc cccccctgtgagcaccacgtgaatggctcccggccctcgtgcacgggggagggggacacc cccaagtgcagcaagatgtgtgagcccggctacaccccatcctacaaggaagacaagcac tatggatgcagctcctacagcctctccagcagcgagaaggagatcatggcggagatctac aagaacggcccggtggaggccgccttctccgtgtactcggacttcctgctctacaagtct ggagtgtaccagcacgtcaccggagacatgatgggaggccacgcagtgcgcatcctgggc tggggagtggaggatggcacgccctactggctggtgggcaactcctggaacactgactgg ggagacagcggcttcttcaagatcctcagaggccaggatcactgtggaattgagtcggaa atcgtggctggaatcccatgcgctgatcagtactga

DBGET integrated database retrieval system