Manis javanica (Malayan pangolin): 108402439 Help Entry 108402439         CDS       T06054                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04010   MAPK signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04020   Calcium signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04810   Regulation of actin cytoskeleton mjv05200   Pathways in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05218   Melanoma mjv05224   Breast cancer mjv05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108402439 (FGF16)    04014 Ras signaling pathway     108402439 (FGF16)    04015 Rap1 signaling pathway     108402439 (FGF16)    04020 Calcium signaling pathway     108402439 (FGF16)    04151 PI3K-Akt signaling pathway     108402439 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108402439 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108402439 (FGF16)    05207 Chemical carcinogenesis - receptor activation     108402439 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     108402439 (FGF16)    05218 Melanoma     108402439 (FGF16)    05224 Breast cancer     108402439 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108402439 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108402439 (FGF16) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Growth factors (RTK binding)    108402439 (FGF16) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Growth factors/receptors    108402439 (FGF16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  108402439 NCBI-ProteinID:  XP_017524490 LinkDB All DBs Position X:64263219..64272073 Genome browser AA seq 207 aa AA seqDB search MAEVGGIFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH QKFTHFLPRPVDPSKLPSMSRDLFRYQ NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcggaggtgggggggatctttgcctctttggactgggatctgcacggcttctcttcg tcgctggggaatgtgcccttagctgactctccgggtttcctgaacgagcgcctgggccaa atcgaggggaaactgcagcgcggctcgcccacagacttcgctcacctgaaggggatcctg cggcgccgtcaactgtactgccgcaccggcttccacctggagatcttccccaacggcacg gtgcacggcacccgccacgaccacagccgcttcggaatcctggagtttatcagcctggct gtggggctgatcagcatccggggagtggactctggcctgtacttaggaatgaacgagaga ggagaactgtatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa gaaaactggtacaacacctatgcctccaccttgtacaaacactcggactctgagagacaa tattatgtggctctgaataaggatggctcaccccgggagggatacaggactaaacgacac cagaaattcactcactttttacccaggccggtagatccttctaagttgccctccatgtcc agagacctcttccgctatcagtag

DBGET integrated database retrieval system