Manis javanica (Malayan pangolin): 108402523 Help Entry 108402523         CDS       T06054                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04024   cAMP signaling pathway mjv04062   Chemokine signaling pathway mjv04064   NF-kappa B signaling pathway mjv04210   Apoptosis mjv04380   Osteoclast differentiation mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04623   Cytosolic DNA-sensing pathway mjv04625   C-type lectin receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04658   Th1 and Th2 cell differentiation mjv04659   Th17 cell differentiation mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04668   TNF signaling pathway mjv04722   Neurotrophin signaling pathway mjv04920   Adipocytokine signaling pathway mjv04926   Relaxin signaling pathway mjv04931   Insulin resistance mjv04936   Alcoholic liver disease mjv05132   Salmonella infection mjv05134   Legionellosis mjv05135   Yersinia infection mjv05140   Leishmaniasis mjv05142   Chagas disease mjv05145   Toxoplasmosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05215   Prostate cancer mjv05220   Chronic myeloid leukemia mjv05222   Small cell lung cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     108402523 (NFKBIA)    04668 TNF signaling pathway     108402523 (NFKBIA)    04024 cAMP signaling pathway     108402523 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     108402523 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108402523 (NFKBIA)    04621 NOD-like receptor signaling pathway     108402523 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     108402523 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     108402523 (NFKBIA)    04625 C-type lectin receptor signaling pathway     108402523 (NFKBIA)    04660 T cell receptor signaling pathway     108402523 (NFKBIA)    04658 Th1 and Th2 cell differentiation     108402523 (NFKBIA)    04659 Th17 cell differentiation     108402523 (NFKBIA)    04657 IL-17 signaling pathway     108402523 (NFKBIA)    04662 B cell receptor signaling pathway     108402523 (NFKBIA)    04062 Chemokine signaling pathway     108402523 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     108402523 (NFKBIA)    04926 Relaxin signaling pathway     108402523 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     108402523 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     108402523 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108402523 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     108402523 (NFKBIA)    05203 Viral carcinogenesis     108402523 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     108402523 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     108402523 (NFKBIA)    05215 Prostate cancer     108402523 (NFKBIA)    05222 Small cell lung cancer     108402523 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     108402523 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     108402523 (NFKBIA)    05161 Hepatitis B     108402523 (NFKBIA)    05160 Hepatitis C     108402523 (NFKBIA)    05171 Coronavirus disease - COVID-19     108402523 (NFKBIA)    05164 Influenza A     108402523 (NFKBIA)    05162 Measles     108402523 (NFKBIA)    05168 Herpes simplex virus 1 infection     108402523 (NFKBIA)    05163 Human cytomegalovirus infection     108402523 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     108402523 (NFKBIA)    05169 Epstein-Barr virus infection     108402523 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     108402523 (NFKBIA)    05135 Yersinia infection     108402523 (NFKBIA)    05134 Legionellosis     108402523 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     108402523 (NFKBIA)    05140 Leishmaniasis     108402523 (NFKBIA)    05142 Chagas disease     108402523 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108402523 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108402523 (NFKBIA)    04931 Insulin resistance     108402523 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mjv03000]     108402523 (NFKBIA)    04131 Membrane trafficking [BR:mjv04131]     108402523 (NFKBIA) Transcription factors [BR:mjv03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     108402523 (NFKBIA) Membrane trafficking [BR:mjv04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     108402523 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  108402523 NCBI-ProteinID:  XP_036881439 LinkDB All DBs Position 8:62910005..62913202 Genome browser AA seq 314 aa AA seqDB search MFQPAEHAPEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAQALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTRGSQHLYSILQTTN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESECTEDEL PYDDCVLGGQRLVL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaacccgccgagcacgctccggagtgggccatggagggccctcgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgggagatccgcctcgagccacaggaggcgccg cgcggcgccgagccctggaagcagcagctcactgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggctctgactatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccatttggctgtgatc accaaccagccagaaattgcccaggcacttttggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagacccgcgggagccagcacctctactccatcttgcagaccaccaac tacaacggtcacacgtgtctgcacttagcctctatccatggctacctgggcattgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaactgcc ctccatctcgctgtggacctgcagaattcagacctggtgtcacttttgttgaaatgtggg gctgatgtcaaccgagtcacctaccagggctactccccctaccagctcacctggggccgc ccgagcacccggatacagcagcagctgggccagttgaccctagaaaatcttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagaatgcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctggtgttataa

DBGET integrated database retrieval system