Manis javanica (Malayan pangolin): 108402592 Help Entry 108402592         CDS       T06054                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05202   Transcriptional misregulation in cancer mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108402592  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     108402592   09163 Immune disease    05322 Systemic lupus erythematosus     108402592   09165 Substance dependence    05034 Alcoholism     108402592  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108402592   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108402592 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108402592 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108402592 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  108402592 NCBI-ProteinID:  XP_017524722 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagaccgcccgcaaatccaccggtggtaaagcaccacggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaaccgcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatacgcaaacttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacgatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system