Manis javanica (Malayan pangolin): 108402614 Help Entry 108402614         CDS       T06054                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04010   MAPK signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04022   cGMP-PKG signaling pathway mjv04066   HIF-1 signaling pathway mjv04068   FoxO signaling pathway mjv04072   Phospholipase D signaling pathway mjv04081   Hormone signaling mjv04114   Oocyte meiosis mjv04140   Autophagy - animal mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04152   AMPK signaling pathway mjv04211   Longevity regulating pathway mjv04213   Longevity regulating pathway - multiple species mjv04810   Regulation of actin cytoskeleton mjv04910   Insulin signaling pathway mjv04911   Insulin secretion mjv04913   Ovarian steroidogenesis mjv04914   Progesterone-mediated oocyte maturation mjv04917   Prolactin signaling pathway mjv04923   Regulation of lipolysis in adipocytes mjv04930   Type II diabetes mellitus mjv04931   Insulin resistance mjv04932   Non-alcoholic fatty liver disease mjv04940   Type I diabetes mellitus mjv04950   Maturity onset diabetes of the young mjv04960   Aldosterone-regulated sodium reabsorption mjv05010   Alzheimer disease mjv05215   Prostate cancer mjv05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108402614 (INS)    04014 Ras signaling pathway     108402614 (INS)    04015 Rap1 signaling pathway     108402614 (INS)    04066 HIF-1 signaling pathway     108402614 (INS)    04068 FoxO signaling pathway     108402614 (INS)    04072 Phospholipase D signaling pathway     108402614 (INS)    04022 cGMP-PKG signaling pathway     108402614 (INS)    04151 PI3K-Akt signaling pathway     108402614 (INS)    04152 AMPK signaling pathway     108402614 (INS)    04150 mTOR signaling pathway     108402614 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     108402614 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108402614 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     108402614 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     108402614 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     108402614 (INS)    04910 Insulin signaling pathway     108402614 (INS)    04923 Regulation of lipolysis in adipocytes     108402614 (INS)    04913 Ovarian steroidogenesis     108402614 (INS)    04914 Progesterone-mediated oocyte maturation     108402614 (INS)    04917 Prolactin signaling pathway     108402614 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     108402614 (INS)   09149 Aging    04211 Longevity regulating pathway     108402614 (INS)    04213 Longevity regulating pathway - multiple species     108402614 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     108402614 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     108402614 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     108402614 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     108402614 (INS)    04940 Type I diabetes mellitus     108402614 (INS)    04950 Maturity onset diabetes of the young     108402614 (INS)    04932 Non-alcoholic fatty liver disease     108402614 (INS)    04931 Insulin resistance     108402614 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108402614 (INS) Cytokines and neuropeptides [BR:mjv04052]  Neuropeptides   Unclassified    108402614 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  108402614 NCBI-ProteinID:  XP_017524755 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MALWMRLLPLLALLALWAPAPTQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED PQVGEVELGGLQPLALEGPLHKRGIVEQCCTSICSLYQLENYCN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggatgcgcctgctgcccctgctggctctgctggccctctgggcgcctgct ccgacccaggcctttgtgaaccagcacctgtgtggctcccacctggtggaggctctgtac ctggtatgcggggaacgtggcttcttctacacacccaaggctcgccgggaggctgaggac ccgcaggtgggcgaggtggagctgggcggcctgcaacccctggccctggaggggcccctg cataagcgtggcatcgtggagcagtgctgcaccagcatctgctctctctaccagctggag aactactgcaactag

DBGET integrated database retrieval system