Manis javanica (Malayan pangolin): 108405585 Help Entry 108405585         CDS       T06054                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05203   Viral carcinogenesis mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108405585  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     108405585   09163 Immune disease    05322 Systemic lupus erythematosus     108405585   09165 Substance dependence    05034 Alcoholism     108405585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108405585 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108405585 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  108405585 NCBI-ProteinID:  XP_017529325 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgtggcaagggtgggaagggtctgggcaaaggcggcgcgaaacgccatcgc aaggtgctgcgggacaacatccaaggcatcaccaagcctgccatccgccgccttgcccgg cgcggcggggtcaaacgcatctccggcctcatttacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagcgcaag acggtcacggctatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc ttcggcggctaa

DBGET integrated database retrieval system