Manis javanica (Malayan pangolin): 108406440 Help Entry 108406440         CDS       T06054                                  Symbol CXCL8 Name (RefSeq) interleukin-8 isoform X1   KO K10030   interleukin 8 Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04060   Cytokine-cytokine receptor interaction mjv04061   Viral protein interaction with cytokine and cytokine receptor mjv04062   Chemokine signaling pathway mjv04064   NF-kappa B signaling pathway mjv04072   Phospholipase D signaling pathway mjv04218   Cellular senescence mjv04620   Toll-like receptor signaling pathway mjv04621   NOD-like receptor signaling pathway mjv04622   RIG-I-like receptor signaling pathway mjv04657   IL-17 signaling pathway mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04936   Alcoholic liver disease mjv05132   Salmonella infection mjv05133   Pertussis mjv05134   Legionellosis mjv05135   Yersinia infection mjv05142   Chagas disease mjv05144   Malaria mjv05146   Amoebiasis mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05171   Coronavirus disease - COVID-19 mjv05200   Pathways in cancer mjv05202   Transcriptional misregulation in cancer mjv05219   Bladder cancer mjv05323   Rheumatoid arthritis mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     108406440 (CXCL8)    04072 Phospholipase D signaling pathway     108406440 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     108406440 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     108406440 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     108406440 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108406440 (CXCL8)    04621 NOD-like receptor signaling pathway     108406440 (CXCL8)    04622 RIG-I-like receptor signaling pathway     108406440 (CXCL8)    04657 IL-17 signaling pathway     108406440 (CXCL8)    04062 Chemokine signaling pathway     108406440 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     108406440 (CXCL8)    05202 Transcriptional misregulation in cancer     108406440 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     108406440 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     108406440 (CXCL8)    05171 Coronavirus disease - COVID-19     108406440 (CXCL8)    05164 Influenza A     108406440 (CXCL8)    05163 Human cytomegalovirus infection     108406440 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     108406440 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     108406440 (CXCL8)    05135 Yersinia infection     108406440 (CXCL8)    05133 Pertussis     108406440 (CXCL8)    05134 Legionellosis     108406440 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     108406440 (CXCL8)    05144 Malaria     108406440 (CXCL8)    05142 Chagas disease     108406440 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     108406440 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     108406440 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     108406440 (CXCL8)    04932 Non-alcoholic fatty liver disease     108406440 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     108406440 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108406440 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:mjv00536]     108406440 (CXCL8) Cytokines and neuropeptides [BR:mjv04052]  Cytokines   Chemokines    108406440 (CXCL8) Glycosaminoglycan binding proteins [BR:mjv00536]  Heparan sulfate / Heparin   Chemokines    108406440 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  108406440 NCBI-ProteinID:  XP_017530626 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAVALLAAFLLSAAVCEAAVLSRISTELRCQCINTHSTPFHPKYIKELRVIESGPH CDHSEIIVKLVSGVEVCLDPKEKWVQKVVQIFLKRAEQQNS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctcgctgttgctcttttggcagctttcctgctttctgcagctgtgtgt gaagctgcagttctgtccaggatcagcacagaacttcgatgccagtgcataaacacacac tccacgcctttccaccccaaatatatcaaagaactgagagtgattgagagtgggccacac tgcgaccattcagaaatcattgttaaacttgtcagtggagtagaggtctgcctggacccc aaggagaagtgggtgcagaaggttgtacagatatttttgaagagagcagagcaacaaaat tcatga

DBGET integrated database retrieval system