Manis javanica (Malayan pangolin): 108408356 Help Entry 108408356         CDS       T06054                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04022   cGMP-PKG signaling pathway mjv04081   Hormone signaling mjv04270   Vascular smooth muscle contraction mjv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     108408356 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     108408356 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     108408356 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     108408356 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mjv04052]     108408356 (NPPC) Cytokines and neuropeptides [BR:mjv04052]  Neuropeptides   Unclassified    108408356 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP DUF1180 Motif Other DBs NCBI-GeneID:  108408356 NCBI-ProteinID:  XP_017533817 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MHLSQLLACVLLLTLLSLRASEAKPGAPPKVQRTPPGEELAEPQAAGGGQKKGDKTTPGG GGANRKGDGSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIG SMSGLGC NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgtcctgctgctcacgctactttcgctccgggcc tccgaagccaagcccggggcgccaccgaaggtccagcgaactccgcccggggaagagctg gccgagccccaagccgcgggcggcggtcagaagaagggcgacaagactactcccgggggt ggcggagccaatcgcaagggcgacgggtcgcgactgctccgggacctgcgcgtggacacc aagtcgcgggcggcatgggcccgccttctgcacgagcaccccaacgcgcgcaaatacaaa ggaggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggattggc tccatgagcggcctgggatgttag

DBGET integrated database retrieval system