Manis javanica (Malayan pangolin): 108409966 Help Entry 108409966         CDS       T06054                                  Name (RefSeq) histone H2B type 2-F isoform X1   KO K11252   histone H2B Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05203   Viral carcinogenesis mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     108409966  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     108409966   09163 Immune disease    05322 Systemic lupus erythematosus     108409966   09165 Substance dependence    05034 Alcoholism     108409966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     108409966   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     108409966 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108409966 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108409966 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-T_C Motif Other DBs NCBI-GeneID:  108409966 NCBI-ProteinID:  XP_036877268 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGTKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatctgctccggctcccaagaagggcactaaaaaagctgttaca aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtctaaagccatg ggcattatgaactcgttcgtcaacgacatcttcgagcgtatcgcgggcgaggcgtcccgc ctggcgcattacaacaagcgctccaccatcacgtcccgggagatccagacggccgtgcgc ctgctgttgcctggcgagctggccaagcatgctgtgtccgagggcaccaaggcggtcacc aagtacaccagttcaaagtaa

DBGET integrated database retrieval system