Manis javanica (Malayan pangolin): 118969036 Help Entry 118969036         CDS       T06054                                  Name (RefSeq) histone H2B type 1-B isoform X1   KO K11252   histone H2B Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv04613   Neutrophil extracellular trap formation mjv05034   Alcoholism mjv05203   Viral carcinogenesis mjv05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mjv00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118969036  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     118969036   09163 Immune disease    05322 Systemic lupus erythematosus     118969036   09165 Substance dependence    05034 Alcoholism     118969036  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mjv03036]     118969036   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     118969036 Chromosome and associated proteins [BR:mjv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     118969036 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118969036 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  118969036 NCBI-ProteinID:  XP_036857855 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPSRSAPAPKKGSKKAISKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggagccttctcgctcagcaccggcgcccaaaaagggttccaaaaaggccatctcc aaggcgcagaaaaaggacggcaagaaacgcaagcgcagccgcaaggagagctactccatc tacgtgtacaaggtgttgaagcaggtgcatccagacaccggcatctcatccaaagccatg ggcatcatgaactcgtttgtcaacgacatcttcgaacgcatcgctagcgaggcctcccgc ctggcgcactacaacaagcgttccaccatcacgtcccgcgaggtgcagacggctgtgcgc ctgctgcttcccggagagctggccaagcacgccgtgtcggagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system