Manis javanica (Malayan pangolin): 118969429 Help Entry 118969429         CDS       T06054                                  Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv01524   Platinum drug resistance mjv04071   Sphingolipid signaling pathway mjv04115   p53 signaling pathway mjv04141   Protein processing in endoplasmic reticulum mjv04210   Apoptosis mjv04211   Longevity regulating pathway mjv04215   Apoptosis - multiple species mjv04217   Necroptosis mjv04722   Neurotrophin signaling pathway mjv04932   Non-alcoholic fatty liver disease mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05132   Salmonella infection mjv05152   Tuberculosis mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05162   Measles mjv05163   Human cytomegalovirus infection mjv05164   Influenza A mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05168   Herpes simplex virus 1 infection mjv05169   Epstein-Barr virus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05202   Transcriptional misregulation in cancer mjv05203   Viral carcinogenesis mjv05210   Colorectal cancer mjv05212   Pancreatic cancer mjv05213   Endometrial cancer mjv05214   Glioma mjv05216   Thyroid cancer mjv05217   Basal cell carcinoma mjv05218   Melanoma mjv05220   Chronic myeloid leukemia mjv05222   Small cell lung cancer mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118969429  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     118969429  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     118969429    04215 Apoptosis - multiple species     118969429    04217 Necroptosis     118969429    04115 p53 signaling pathway     118969429  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     118969429   09149 Aging    04211 Longevity regulating pathway     118969429  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118969429    05202 Transcriptional misregulation in cancer     118969429    05203 Viral carcinogenesis     118969429   09162 Cancer: specific types    05210 Colorectal cancer     118969429    05212 Pancreatic cancer     118969429    05225 Hepatocellular carcinoma     118969429    05226 Gastric cancer     118969429    05214 Glioma     118969429    05216 Thyroid cancer     118969429    05220 Chronic myeloid leukemia     118969429    05217 Basal cell carcinoma     118969429    05218 Melanoma     118969429    05213 Endometrial cancer     118969429    05224 Breast cancer     118969429    05222 Small cell lung cancer     118969429    05223 Non-small cell lung cancer     118969429   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118969429    05170 Human immunodeficiency virus 1 infection     118969429    05161 Hepatitis B     118969429    05160 Hepatitis C     118969429    05164 Influenza A     118969429    05162 Measles     118969429    05168 Herpes simplex virus 1 infection     118969429    05163 Human cytomegalovirus infection     118969429    05167 Kaposi sarcoma-associated herpesvirus infection     118969429    05169 Epstein-Barr virus infection     118969429    05165 Human papillomavirus infection     118969429   09171 Infectious disease: bacterial    05132 Salmonella infection     118969429    05152 Tuberculosis     118969429   09164 Neurodegenerative disease    05012 Parkinson disease     118969429    05014 Amyotrophic lateral sclerosis     118969429    05016 Huntington disease     118969429    05020 Prion disease     118969429    05022 Pathways of neurodegeneration - multiple diseases     118969429   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118969429   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     118969429    04933 AGE-RAGE signaling pathway in diabetic complications     118969429   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     118969429    01524 Platinum drug resistance     118969429    01522 Endocrine resistance     118969429  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mjv03029]     118969429   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mjv02000]     118969429 Mitochondrial biogenesis [BR:mjv03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     118969429 Transporters [BR:mjv02000]  Other transporters   Pores ion channels [TC:1]    118969429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 TetR_C_30 Motif Other DBs NCBI-GeneID:  118969429 NCBI-ProteinID:  XP_036859650 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMG WTMDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgattgcagctgtcgacacagactccccccgcgaggtctttttccgagtggcagccgat atgttttccgatggcaacttcaactggggccgggtagtcgccctcttctactttgccagc aaactggtgctgaaggccctgtgcaccaaggtgcccgaactgattaggaccatcatgggc tggacaatggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgg gatggccttctctcctactttgggacacccacgtggcagaccgtgaccatctttgtggct ggagtgctcacggcatcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system