Manis javanica (Malayan pangolin): 140843067 Help Entry 140843067         CDS       T06054                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv01521   EGFR tyrosine kinase inhibitor resistance mjv01522   Endocrine resistance mjv04010   MAPK signaling pathway mjv04012   ErbB signaling pathway mjv04014   Ras signaling pathway mjv04015   Rap1 signaling pathway mjv04062   Chemokine signaling pathway mjv04068   FoxO signaling pathway mjv04071   Sphingolipid signaling pathway mjv04072   Phospholipase D signaling pathway mjv04137   Mitophagy - animal mjv04140   Autophagy - animal mjv04144   Endocytosis mjv04150   mTOR signaling pathway mjv04151   PI3K-Akt signaling pathway mjv04210   Apoptosis mjv04211   Longevity regulating pathway mjv04213   Longevity regulating pathway - multiple species mjv04218   Cellular senescence mjv04360   Axon guidance mjv04370   VEGF signaling pathway mjv04371   Apelin signaling pathway mjv04510   Focal adhesion mjv04540   Gap junction mjv04550   Signaling pathways regulating pluripotency of stem cells mjv04625   C-type lectin receptor signaling pathway mjv04630   JAK-STAT signaling pathway mjv04650   Natural killer cell mediated cytotoxicity mjv04660   T cell receptor signaling pathway mjv04662   B cell receptor signaling pathway mjv04664   Fc epsilon RI signaling pathway mjv04714   Thermogenesis mjv04720   Long-term potentiation mjv04722   Neurotrophin signaling pathway mjv04725   Cholinergic synapse mjv04726   Serotonergic synapse mjv04730   Long-term depression mjv04810   Regulation of actin cytoskeleton mjv04910   Insulin signaling pathway mjv04912   GnRH signaling pathway mjv04915   Estrogen signaling pathway mjv04916   Melanogenesis mjv04917   Prolactin signaling pathway mjv04919   Thyroid hormone signaling pathway mjv04921   Oxytocin signaling pathway mjv04926   Relaxin signaling pathway mjv04929   GnRH secretion mjv04933   AGE-RAGE signaling pathway in diabetic complications mjv04935   Growth hormone synthesis, secretion and action mjv05010   Alzheimer disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05034   Alcoholism mjv05132   Salmonella infection mjv05160   Hepatitis C mjv05161   Hepatitis B mjv05163   Human cytomegalovirus infection mjv05165   Human papillomavirus infection mjv05166   Human T-cell leukemia virus 1 infection mjv05167   Kaposi sarcoma-associated herpesvirus infection mjv05170   Human immunodeficiency virus 1 infection mjv05200   Pathways in cancer mjv05203   Viral carcinogenesis mjv05205   Proteoglycans in cancer mjv05206   MicroRNAs in cancer mjv05207   Chemical carcinogenesis - receptor activation mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05210   Colorectal cancer mjv05211   Renal cell carcinoma mjv05213   Endometrial cancer mjv05214   Glioma mjv05215   Prostate cancer mjv05216   Thyroid cancer mjv05218   Melanoma mjv05219   Bladder cancer mjv05220   Chronic myeloid leukemia mjv05221   Acute myeloid leukemia mjv05223   Non-small cell lung cancer mjv05224   Breast cancer mjv05225   Hepatocellular carcinoma mjv05226   Gastric cancer mjv05230   Central carbon metabolism in cancer mjv05231   Choline metabolism in cancer mjv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mjv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mjv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     140843067    04012 ErbB signaling pathway     140843067    04014 Ras signaling pathway     140843067    04015 Rap1 signaling pathway     140843067    04370 VEGF signaling pathway     140843067    04371 Apelin signaling pathway     140843067    04630 JAK-STAT signaling pathway     140843067    04068 FoxO signaling pathway     140843067    04072 Phospholipase D signaling pathway     140843067    04071 Sphingolipid signaling pathway     140843067    04151 PI3K-Akt signaling pathway     140843067    04150 mTOR signaling pathway     140843067  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     140843067    04140 Autophagy - animal     140843067    04137 Mitophagy - animal     140843067   09143 Cell growth and death    04210 Apoptosis     140843067    04218 Cellular senescence     140843067   09144 Cellular community - eukaryotes    04510 Focal adhesion     140843067    04540 Gap junction     140843067    04550 Signaling pathways regulating pluripotency of stem cells     140843067   09142 Cell motility    04810 Regulation of actin cytoskeleton     140843067  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     140843067    04650 Natural killer cell mediated cytotoxicity     140843067    04660 T cell receptor signaling pathway     140843067    04662 B cell receptor signaling pathway     140843067    04664 Fc epsilon RI signaling pathway     140843067    04062 Chemokine signaling pathway     140843067   09152 Endocrine system    04910 Insulin signaling pathway     140843067    04929 GnRH secretion     140843067    04912 GnRH signaling pathway     140843067    04915 Estrogen signaling pathway     140843067    04917 Prolactin signaling pathway     140843067    04921 Oxytocin signaling pathway     140843067    04926 Relaxin signaling pathway     140843067    04935 Growth hormone synthesis, secretion and action     140843067    04919 Thyroid hormone signaling pathway     140843067    04916 Melanogenesis     140843067   09156 Nervous system    04725 Cholinergic synapse     140843067    04726 Serotonergic synapse     140843067    04720 Long-term potentiation     140843067    04730 Long-term depression     140843067    04722 Neurotrophin signaling pathway     140843067   09158 Development and regeneration    04360 Axon guidance     140843067   09149 Aging    04211 Longevity regulating pathway     140843067    04213 Longevity regulating pathway - multiple species     140843067   09159 Environmental adaptation    04714 Thermogenesis     140843067  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     140843067    05206 MicroRNAs in cancer     140843067    05205 Proteoglycans in cancer     140843067    05207 Chemical carcinogenesis - receptor activation     140843067    05208 Chemical carcinogenesis - reactive oxygen species     140843067    05203 Viral carcinogenesis     140843067    05230 Central carbon metabolism in cancer     140843067    05231 Choline metabolism in cancer     140843067    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     140843067   09162 Cancer: specific types    05210 Colorectal cancer     140843067    05225 Hepatocellular carcinoma     140843067    05226 Gastric cancer     140843067    05214 Glioma     140843067    05216 Thyroid cancer     140843067    05221 Acute myeloid leukemia     140843067    05220 Chronic myeloid leukemia     140843067    05218 Melanoma     140843067    05211 Renal cell carcinoma     140843067    05219 Bladder cancer     140843067    05215 Prostate cancer     140843067    05213 Endometrial cancer     140843067    05224 Breast cancer     140843067    05223 Non-small cell lung cancer     140843067   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     140843067    05170 Human immunodeficiency virus 1 infection     140843067    05161 Hepatitis B     140843067    05160 Hepatitis C     140843067    05163 Human cytomegalovirus infection     140843067    05167 Kaposi sarcoma-associated herpesvirus infection     140843067    05165 Human papillomavirus infection     140843067   09171 Infectious disease: bacterial    05132 Salmonella infection     140843067   09164 Neurodegenerative disease    05010 Alzheimer disease     140843067    05022 Pathways of neurodegeneration - multiple diseases     140843067   09165 Substance dependence    05034 Alcoholism     140843067   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     140843067   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     140843067   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     140843067    01522 Endocrine resistance     140843067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mjv04131]     140843067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mjv04147]     140843067    04031 GTP-binding proteins [BR:mjv04031]     140843067 Membrane trafficking [BR:mjv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     140843067  Endocytosis   Macropinocytosis    Ras GTPases     140843067 Exosome [BR:mjv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    140843067   Exosomal proteins of colorectal cancer cells    140843067 GTP-binding proteins [BR:mjv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     140843067 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 FeoB_N RsgA_GTPase ATP_bind_1 AAA_28 SRPRB AAA_22 Motif Other DBs NCBI-GeneID:  140843067 NCBI-ProteinID:  XP_073084486 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MAEYKVAVVGAEAVGKSALTIRLTHNHFVEVYDPTIMDSYRKQLIIDGESCVLDILDTAG QEEFRAIWDQYMRTAEGFLCVFAINNTKSFEDIHQYREQIRRLKDSDDVPVVLVGNKCDL AARTVESQQAQDLARSHGIPYIETSAKTRQGVEDAFYTLVHEIRQHKACKLSPPDEGSPG CKCLLS NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggcggaatataaggtcgcggtggtgggcgccgaggctgtggggaagagtgccctgacc atccggctcacccataaccatttcgtggaagtgtatgaccccaccatcatggattcctac cggaagcaactgatcattgatggtgagtcgtgtgtgctggacatcctggacacggcgggc caggaggagttcagggccatatgggaccagtacatgcgcactgcggagggcttcctgtgt gtgtttgcaattaacaacaccaaatccttcgaggacatccaccaatacagggagcagatc aggcggctgaaggactcagatgatgtgcccgtcgtcctagtagggaacaagtgtgacctg gctgcacgcaccgtggagtctcagcaggcacaggaccttgcccgaagccatggcatcccc tacatagagacgtcggccaagacacgccagggcgtggaggatgccttctacaccctggtg catgagatccggcagcacaaggcgtgcaaactaagcccaccggacgagggcagcccgggc tgcaaatgcctgctctcctga

DBGET integrated database retrieval system