Manis javanica (Malayan pangolin): 24019680 Help Entry 24019680          CDS       T06054                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism mjv  Manis javanica (Malayan pangolin) Pathway mjv00190   Oxidative phosphorylation mjv01100   Metabolic pathways mjv04714   Thermogenesis mjv04723   Retrograde endocannabinoid signaling mjv05010   Alzheimer disease mjv05012   Parkinson disease mjv05014   Amyotrophic lateral sclerosis mjv05016   Huntington disease mjv05020   Prion disease mjv05022   Pathways of neurodegeneration - multiple diseases mjv05208   Chemical carcinogenesis - reactive oxygen species mjv05415   Diabetic cardiomyopathy Module mjv_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mjv00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     24019680 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     24019680 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     24019680 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     24019680 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     24019680 (ND6)    05012 Parkinson disease     24019680 (ND6)    05014 Amyotrophic lateral sclerosis     24019680 (ND6)    05016 Huntington disease     24019680 (ND6)    05020 Prion disease     24019680 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     24019680 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     24019680 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mjv03029]     24019680 (ND6) Enzymes [BR:mjv01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      24019680 (ND6) Mitochondrial biogenesis [BR:mjv03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     24019680 (ND6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q3 Motif Other DBs NCBI-GeneID:  24019680 NCBI-ProteinID:  YP_009129935 UniProt:  A0A0D3QKQ6 LinkDB All DBs Position MT AA seq 174 aa AA seqDB search MTYVVFILSVIFVISFLGFSSKPSPIYGGFSLVVAGGAGCGVVVNFGGSFLGLMVFLIYL GGMLVVFGYTAAMAIEEYPEVWVSNVVVLGAFVLGVVMELVLVLYMLKGEGLSVVFDLGG PGDWATYDVGGSSFFSEEAAGVAALYSHGAWFVIMTGWSLFICVVVVMEVTRGN NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgacatatgttgtgtttattttgagtgttatttttgtgattagttttttagggttttct tcaaagccttctcctatttatggggggtttagtctggttgtagctggcggtgcaggttgt ggggttgtagttaattttggtgggtcttttttgggtttaatggtttttttgatttatctt ggggggatgttggttgtttttggttatacggcggccatagccattgaggagtatcctgaa gtttgggtgtctaatgtggttgtgctcggtgcttttgttttgggtgtggtcatagagttg gttttagtgctttatatgttgaagggtgaggggttgagtgtggtttttgatcttggtggt cctggtgattgggcgacttatgatgttggggggtctagtttttttagtgaggaagctgcg ggtgttgctgctctttatagccatggtgcttggtttgtgattatgaccgggtggtctttg tttatttgtgttgttgttgttatggaggttactcgggggaataga

DBGET integrated database retrieval system