Methanopyrus kandleri: MK1455 Help Entry MK1455            CDS       T00078                                  Symbol rps31 Name (GenBank) Ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mka  Methanopyrus kandleri Pathway mka03010   Ribosome Brite KEGG Orthology (KO) [BR:mka00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MK1455 (rps31)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MK1455 (rps31)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mka03011]     MK1455 (rps31)    04121 Ubiquitin system [BR:mka04121]     MK1455 (rps31)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mka04147]     MK1455 (rps31) Ribosome [BR:mka03011]  Ribosomal proteins   Eukaryotes    Small subunit     MK1455 (rps31)   Archaea     MK1455 (rps31) Ubiquitin system [BR:mka04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MK1455 (rps31) Exosome [BR:mka04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MK1455 (rps31)   Exosomal proteins of colorectal cancer cells    MK1455 (rps31) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_NUD Zn_ribbon_RPB9 Cas12f1-like_TNB GFA Lar_restr_allev Zn_ribbon_IS1595 Zn_ribbon_TiaS Zn_ribbon_13 Zn_Ribbon_TF Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AAM02668 UniProt:  Q8TVD7 LinkDB All DBs Position 1482701..1482883 Genome browser AA seq 60 aa AA seqDB search MGVPRRAKLYEVKDGKVERKNPFCPRCGPGVFMADHGNRYACGRCGYTEFKDQPEPKKKK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgggtgtgcccaggagggctaagctgtacgaggttaaggacggtaaggtggagcgcaaa aacccgttctgcccaagatgcgggcccggcgtattcatggcggaccacgggaaccggtat gcgtgcggtaggtgtggatacaccgagttcaaggaccagccggagcccaagaaaaagaag taa

DBGET integrated database retrieval system