Marinimicrobium sp. C6131: OOT55_05455 Help Entry OOT55_05455       CDS       T08615                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mke  Marinimicrobium sp. C6131 Pathway mke01100   Metabolic pathways mke01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mke00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OOT55_05455 (acpP)    00074 Mycolic acid biosynthesis     OOT55_05455 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OOT55_05455 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Gag_p24_C Motif Other DBs NCBI-ProteinID:  UZJ45501 LinkDB All DBs Position complement(1295390..1295626) Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINANLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgggttaaaaaaattgttgccgagcaactgggtgtgaaagaa gaagaagttaaaaacgaagcttctttcgtcgaagatctgggtgccgactctctcgatacc gtcgagctggtaatggctctggaagaggaattcgaaaccgaaattccggacgaagaagcc gagaagatcaccactgttcagttggctatcgattacatcaatgccaacctggcgtaa

DBGET integrated database retrieval system