KEGG   Marinimicrobium sp. C6131: OOT55_10475
Entry
OOT55_10475       CDS       T08615                                 
Name
(GenBank) ATP-binding cassette domain-containing protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
mke  Marinimicrobium sp. C6131
Pathway
mke02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mke00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    OOT55_10475
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mke02000]
    OOT55_10475
Enzymes [BR:mke01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     OOT55_10475
Transporters [BR:mke02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    OOT55_10475
SSDB
Motif
Pfam: ABC_tran RsgA_GTPase AAA_30 AAA_29 MMR_HSR1 DO-GTPase2 NACHT ATP-synt_ab AAA_25 AAA_16 AAA_22 AAA_21 DUF87 AAA_24 NB-ARC
Other DBs
NCBI-ProteinID: UZJ43076
LinkDB
Position
2421420..2422073
AA seq 217 aa
MTALSLNDVVADYGELRVLGPLSLDVVRGQTVALVGKSGAGKSTLLSLMYQQWRPLGAAL
MPQDLGLVPTLSVFHNVYMGGLHRHSTMHNLLSLLRPFRQDVEQIRPILQTLDIDHKCWT
ATGELSGGQRQRVAAARVIHQQGDVLLADEPASALDGPMAERVLAALTHAYPTAVLAMHD
VDLALHFADRVVGIANGGIALDEPRERLQASDLLTLY
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaccgcactgtcgcttaacgacgtggtcgccgactacggcgagctgcgtgtgctcggc
cccctcagtctggatgtggtacgcggtcagaccgtggccctggtcggcaagagcggggcc
ggcaagtccactctgctcagtctgatgtaccagcagtggcgcccattgggcgctgcgttg
atgcctcaggacctcggactggtcccgaccctgagcgtgtttcacaacgtgtatatgggg
ggactgcaccggcactccacgatgcacaacctgctgtcgttgctgcgcccgttcaggcag
gatgtcgagcagattcgtcccatcctgcagaccctcgatatcgaccacaaatgctggacc
gccaccggagagctttccggcggtcaacgtcagcgtgtggcggcggcgcgggtcattcac
cagcaaggcgacgtactgctggcggatgagccggcctcagcccttgatggtcccatggcc
gagcgggtgctggcggcgctgacccatgcctaccccactgcggtgcttgccatgcacgat
gtcgacctggccctgcatttcgccgatcgggtggtgggcatcgccaacggcggcatcgcc
ctggacgaaccccgcgaacgactgcaggcgagtgacctgctgacgctgtactga

DBGET integrated database retrieval system