Mycobacterium kansasii ATCC 12478: MKAN_15520 Help Entry MKAN_15520        CDS       T02887                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism mkn  Mycobacterium kansasii ATCC 12478 Pathway mkn01100   Metabolic pathways mkn01110   Biosynthesis of secondary metabolites Module mkn_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mkn_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mkn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MKAN_15520    00074 Mycolic acid biosynthesis     MKAN_15520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MKAN_15520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AGZ51518 UniProt:  U5WQM3 LinkDB All DBs Position complement(3384498..3384812) Genome browser AA seq 104 aa AA seqDB search MTENRSALILPEAGEVIGAFRDALEKVLAPEDLAQVDLVRVDSETPLLSLPIDSAVLMSL MTELEDRFAVFIDEEAAFAFETVADITDYVRRRLTDKAGRLAGA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaccgaaaaccgctccgcgctgatactcccggaggccggcgaagtcatcggcgccttc cgcgatgccctcgagaaggtgctggcgcccgaggatctcgcgcaggttgacctcgtccgg gtcgactccgaaacaccgctactcagcctgcccatcgactctgccgtactgatgtcgttg atgaccgagctcgaggacaggttcgcggtgttcatcgacgaagaggcggcattcgcgttc gaaaccgtcgccgatatcacggactacgtgcgacgacggctgaccgacaaggccggccgg ctggccggcgcgtga

DBGET integrated database retrieval system