Methylomonas koyamae: MKLM6_1234 Help Entry MKLM6_1234        CDS       T05118                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mko  Methylomonas koyamae Pathway mko01100   Metabolic pathways mko01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mko00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MKLM6_1234    00074 Mycolic acid biosynthesis     MKLM6_1234   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MKLM6_1234 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 Gag_p24_C Motif Other DBs NCBI-ProteinID:  ATG89490 LinkDB All DBs Position 1326046..1326279 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVAEQLGVKEEIANDASFVDDLGADSLDTVELVMALEEEFECEIPDEEAE KITTVQLAIDYINANLQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtaatatcgaagaacgagtaaaaaagattgtcgcggaacaattaggcgtaaaggaa gaaatcgcaaacgatgcgtcttttgtcgacgatcttggtgctgattctttagacacagtt gaactcgtcatggctttggaagaagaattcgaatgcgaaattccggacgaagaagccgaa aaaatcaccaccgtccaattggctatcgattacatcaacgccaatctgcaataa

DBGET integrated database retrieval system