Methylomonas koyamae: MKLM6_1620 Help Entry MKLM6_1620        CDS       T05118                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mko  Methylomonas koyamae Pathway mko03060   Protein export mko03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mko00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MKLM6_1620  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MKLM6_1620  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mko02044]     MKLM6_1620 Secretion system [BR:mko02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MKLM6_1620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E PTR2 Motif Other DBs NCBI-ProteinID:  ATG89863 UniProt:  A0A291IHP2 LinkDB All DBs Position 1768185..1768391 Genome browser AA seq 68 aa AA seqDB search MGFSVPHLLVVLAIVVLVFGTKRLKDVGADLGDAIKGFRKAVQEGEADAAGAGNDRLLND ANLSKTEQ NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgggttttagcgttccgcacttattggtagtgctggcaatagtggtactggtattcggc accaagcgtctgaaagacgtcggcgccgacttgggcgatgcgatcaagggctttcgcaaa gcggtacaagagggcgaagcggatgcggccggcgccggcaacgaccgcttgctgaacgac gccaatctgtcgaaaaccgagcagtaa

DBGET integrated database retrieval system