Mycobacterium kiyosense: IWGMT90018_31140 Help Entry IWGMT90018_31140  CDS       T09155                                  Name (GenBank) hypothetical protein   KO K03186   flavin prenyltransferase [EC:2.5.1.129] Organism mky  Mycobacterium kiyosense Pathway mky00130   Ubiquinone and other terpenoid-quinone biosynthesis mky00627   Aminobenzoate degradation mky00740   Riboflavin metabolism mky00900   Terpenoid backbone biosynthesis mky01100   Metabolic pathways mky01110   Biosynthesis of secondary metabolites mky01120   Microbial metabolism in diverse environments mky01220   Degradation of aromatic compounds mky01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mky00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00740 Riboflavin metabolism     IWGMT90018_31140    00130 Ubiquinone and other terpenoid-quinone biosynthesis     IWGMT90018_31140   09109 Metabolism of terpenoids and polyketides    00900 Terpenoid backbone biosynthesis     IWGMT90018_31140   09111 Xenobiotics biodegradation and metabolism    00627 Aminobenzoate degradation     IWGMT90018_31140 Enzymes [BR:mky01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.129  flavin prenyltransferase      IWGMT90018_31140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Flavoprotein Motif Other DBs NCBI-ProteinID:  BDB42668 LinkDB All DBs Position complement(3155134..3155487) Genome browser AA seq 117 aa AA seqDB search MLIAPASMRSVGEIAGGVSSSLLSRAADVVLKERRPLVLMVREAPLNLIHLRNMATITEA GGTIFPPVPAFYFRPTTIEDIVDHSVGRALDQFGIHTDVFPRWDEDLRHSVVRRSED NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgctcatcgcgccggcatcgatgcgcagcgtcggggaaatcgccggcggcgtcagctcg tcgctgttgtcgcgggcggccgacgtcgtcctcaaagagcgccgaccgttggtgctcatg gttcgtgaggcgccgctcaacctcatccatctgcgcaacatggccaccatcaccgaagcc ggcggcaccatctttccgccggtgcccgcgttctactttcggccgaccaccatcgaggac atcgtcgaccattccgtcgggcgggcgctggaccagttcggcatccacaccgacgtgttt ccccggtgggacgaggacctgcggcacagcgtcgttcgtcgcagcgaagactaa

DBGET integrated database retrieval system