Methanocorpusculum labreanum: Mlab_0654 Help Entry Mlab_0654         CDS       T00472                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mla  Methanocorpusculum labreanum Pathway mla03010   Ribosome Brite KEGG Orthology (KO) [BR:mla00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mlab_0654   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mlab_0654  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mla03011]     Mlab_0654    04121 Ubiquitin system [BR:mla04121]     Mlab_0654   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mla04147]     Mlab_0654 Ribosome [BR:mla03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mlab_0654   Archaea     Mlab_0654 Ubiquitin system [BR:mla04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mlab_0654 Exosome [BR:mla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mlab_0654   Exosomal proteins of colorectal cancer cells    Mlab_0654 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Cas12f1-like_TNB Zn_ribbon_Nudix Zn_ribbon_IS1595 HVO_2753_ZBP Lar_restr_allev DUF7560 Rcat_RNF216 Zn_ribbon_3 Ribosomal_L32p Zn_ribbon_11 Phage_GP58 DUF2310 Zn_ribbon_NUD DUF1936 Motif Other DBs NCBI-ProteinID:  ABN06827 UniProt:  A2SR71 LinkDB All DBs Position complement(626603..626785) Genome browser AA seq 60 aa AA seqDB search MAAKKVVKATPKRSELYTVDAQGKATTSHRACPRCGAGVFMGEHKDRFSCGKCGYTEFKQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggcagcgaagaaggtcgtcaaagcgacaccaaaacgcagcgaactttacactgttgat gcccagggaaaagcaaccacctctcaccgtgcatgcccgcgctgcggagccggtgtcttc atgggcgaacacaaagaccggttttcctgcggaaagtgcggatacaccgagtttaagcaa taa

DBGET integrated database retrieval system