Methanospirillum lacunae: ACKUB0_06295 Help Entry ACKUB0_06295      CDS       T11317                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mlaa  Methanospirillum lacunae Pathway mlaa03010   Ribosome Brite KEGG Orthology (KO) [BR:mlaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     ACKUB0_06295   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     ACKUB0_06295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mlaa03011]     ACKUB0_06295    04121 Ubiquitin system [BR:mlaa04121]     ACKUB0_06295   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlaa04147]     ACKUB0_06295 Ribosome [BR:mlaa03011]  Ribosomal proteins   Eukaryotes    Small subunit     ACKUB0_06295   Archaea     ACKUB0_06295 Ubiquitin system [BR:mlaa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    ACKUB0_06295 Exosome [BR:mlaa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    ACKUB0_06295   Exosomal proteins of colorectal cancer cells    ACKUB0_06295 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e IBR Zn_ribbon_Nudix Zn_Ribbon_1 DUF1451 MqsA_antitoxin Phage_gp86 DUF3027 zf-C2H2_ZN142 Zn_ribbon_13 Zn_ribbon_NUD Motif Other DBs NCBI-ProteinID:  XLR77025 LinkDB All DBs Position 1277196..1277384 Genome browser AA seq 62 aa AA seqDB search MAAKGKKEKTSVKRSAYFTVSGKTATPSRRYCPRCGPGVFMGEHKDRASCGKCGYTEFKN KA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggcagcaaaaggtaagaaagagaagacatctgtcaaacgttcagcatacttcactgta agcggaaagactgcaaccccgtcacgccggtactgtccacgctgtggtccgggtgttttt atgggcgagcacaaggatcgtgcaagctgcggtaagtgcggatacaccgaatttaagaac aaagcctga

DBGET integrated database retrieval system