Macrotis lagotis (bilby): 141487793 Help Entry 141487793         CDS       T11097                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism mlao  Macrotis lagotis (bilby) Pathway mlao00190   Oxidative phosphorylation mlao01100   Metabolic pathways mlao01524   Platinum drug resistance mlao04115   p53 signaling pathway mlao04210   Apoptosis mlao04215   Apoptosis - multiple species mlao04932   Non-alcoholic fatty liver disease mlao05010   Alzheimer disease mlao05012   Parkinson disease mlao05014   Amyotrophic lateral sclerosis mlao05016   Huntington disease mlao05017   Spinocerebellar ataxia mlao05020   Prion disease mlao05022   Pathways of neurodegeneration - multiple diseases mlao05132   Salmonella infection mlao05134   Legionellosis mlao05145   Toxoplasmosis mlao05152   Tuberculosis mlao05160   Hepatitis C mlao05161   Hepatitis B mlao05162   Measles mlao05163   Human cytomegalovirus infection mlao05164   Influenza A mlao05167   Kaposi sarcoma-associated herpesvirus infection mlao05168   Herpes simplex virus 1 infection mlao05169   Epstein-Barr virus infection mlao05170   Human immunodeficiency virus 1 infection mlao05200   Pathways in cancer mlao05210   Colorectal cancer mlao05222   Small cell lung cancer mlao05416   Viral myocarditis mlao05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     141487793  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     141487793    04215 Apoptosis - multiple species     141487793    04115 p53 signaling pathway     141487793  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141487793   09162 Cancer: specific types    05210 Colorectal cancer     141487793    05222 Small cell lung cancer     141487793   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     141487793    05161 Hepatitis B     141487793    05160 Hepatitis C     141487793    05164 Influenza A     141487793    05162 Measles     141487793    05168 Herpes simplex virus 1 infection     141487793    05163 Human cytomegalovirus infection     141487793    05167 Kaposi sarcoma-associated herpesvirus infection     141487793    05169 Epstein-Barr virus infection     141487793   09171 Infectious disease: bacterial    05132 Salmonella infection     141487793    05134 Legionellosis     141487793    05152 Tuberculosis     141487793   09174 Infectious disease: parasitic    05145 Toxoplasmosis     141487793   09164 Neurodegenerative disease    05010 Alzheimer disease     141487793    05012 Parkinson disease     141487793    05014 Amyotrophic lateral sclerosis     141487793    05016 Huntington disease     141487793    05017 Spinocerebellar ataxia     141487793    05020 Prion disease     141487793    05022 Pathways of neurodegeneration - multiple diseases     141487793   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141487793    05416 Viral myocarditis     141487793   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     141487793   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     141487793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  141487793 NCBI-ProteinID:  XP_074043437 LinkDB All DBs Position 1:754089249..754089563 Genome browser AA seq 104 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTSPNLHGLFGLKTGQAVGFSSTDAKKIKGITW GEDTLMEYLSPKKYIPGKKMIFTGIKKKGERADLIAYLKKATNE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggggacgtggagaagggcaagaagatctttgtacagaagtgcgcccagtgccacacg gtggagaagggcggcaagcacaagaccagccccaacctgcatgggctcttcggcctcaag acgggccaggcggtgggcttctcctccaccgatgccaaaaagatcaaagggatcacctgg ggagaggacaccttgatggagtacctgagccccaagaagtacatccctggcaagaagatg atcttcacaggcatcaagaagaagggggagagggccgacttgatagcctacctgaagaag gccaccaacgagtaa

DBGET integrated database retrieval system