Macrotis lagotis (bilby): 141488627 Help Entry 141488627         CDS       T11097                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism mlao  Macrotis lagotis (bilby) Pathway mlao04382   Cornified envelope formation mlao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlao00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     141488627 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141488627 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141488627 (S100A10) Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of microglial cells    141488627 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 Motif Other DBs NCBI-GeneID:  141488627 NCBI-ProteinID:  XP_074044970 LinkDB All DBs Position 5:complement(230376501..230390972) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLIIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaactatgatgtttacctttcataagtttgct ggagacaaaggctacttaacaaaagaagatctaagagttctcatggaaaaagagttccct ggattcttggaaaaccagaaagaccctttagctgtagacaagattatgaaagatctggac caatgcagagatggaaaagtgggcttccagagcttcttttcacttattgctgggttgatc atcgcatgcaacgactattttgtcgtacatatgaagcagaaggggaaaaaatga

DBGET integrated database retrieval system