Macrotis lagotis (bilby): 141488775 Help Entry 141488775         CDS       T11097                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism mlao  Macrotis lagotis (bilby) Pathway mlao04014   Ras signaling pathway mlao04015   Rap1 signaling pathway mlao04020   Calcium signaling pathway mlao04022   cGMP-PKG signaling pathway mlao04024   cAMP signaling pathway mlao04070   Phosphatidylinositol signaling system mlao04114   Oocyte meiosis mlao04218   Cellular senescence mlao04261   Adrenergic signaling in cardiomyocytes mlao04270   Vascular smooth muscle contraction mlao04371   Apelin signaling pathway mlao04625   C-type lectin receptor signaling pathway mlao04713   Circadian entrainment mlao04720   Long-term potentiation mlao04722   Neurotrophin signaling pathway mlao04728   Dopaminergic synapse mlao04740   Olfactory transduction mlao04744   Phototransduction mlao04750   Inflammatory mediator regulation of TRP channels mlao04910   Insulin signaling pathway mlao04912   GnRH signaling pathway mlao04915   Estrogen signaling pathway mlao04916   Melanogenesis mlao04921   Oxytocin signaling pathway mlao04922   Glucagon signaling pathway mlao04924   Renin secretion mlao04925   Aldosterone synthesis and secretion mlao04970   Salivary secretion mlao04971   Gastric acid secretion mlao05010   Alzheimer disease mlao05012   Parkinson disease mlao05022   Pathways of neurodegeneration - multiple diseases mlao05031   Amphetamine addiction mlao05034   Alcoholism mlao05133   Pertussis mlao05152   Tuberculosis mlao05163   Human cytomegalovirus infection mlao05167   Kaposi sarcoma-associated herpesvirus infection mlao05170   Human immunodeficiency virus 1 infection mlao05200   Pathways in cancer mlao05214   Glioma mlao05417   Lipid and atherosclerosis mlao05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     141488775    04015 Rap1 signaling pathway     141488775    04371 Apelin signaling pathway     141488775    04020 Calcium signaling pathway     141488775    04070 Phosphatidylinositol signaling system     141488775    04024 cAMP signaling pathway     141488775    04022 cGMP-PKG signaling pathway     141488775  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     141488775    04218 Cellular senescence     141488775  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     141488775   09152 Endocrine system    04910 Insulin signaling pathway     141488775    04922 Glucagon signaling pathway     141488775    04912 GnRH signaling pathway     141488775    04915 Estrogen signaling pathway     141488775    04921 Oxytocin signaling pathway     141488775    04916 Melanogenesis     141488775    04924 Renin secretion     141488775    04925 Aldosterone synthesis and secretion     141488775   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     141488775    04270 Vascular smooth muscle contraction     141488775   09154 Digestive system    04970 Salivary secretion     141488775    04971 Gastric acid secretion     141488775   09156 Nervous system    04728 Dopaminergic synapse     141488775    04720 Long-term potentiation     141488775    04722 Neurotrophin signaling pathway     141488775   09157 Sensory system    04744 Phototransduction     141488775    04740 Olfactory transduction     141488775    04750 Inflammatory mediator regulation of TRP channels     141488775   09159 Environmental adaptation    04713 Circadian entrainment     141488775  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141488775   09162 Cancer: specific types    05214 Glioma     141488775   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     141488775    05163 Human cytomegalovirus infection     141488775    05167 Kaposi sarcoma-associated herpesvirus infection     141488775   09171 Infectious disease: bacterial    05133 Pertussis     141488775    05152 Tuberculosis     141488775   09164 Neurodegenerative disease    05010 Alzheimer disease     141488775    05012 Parkinson disease     141488775    05022 Pathways of neurodegeneration - multiple diseases     141488775   09165 Substance dependence    05031 Amphetamine addiction     141488775    05034 Alcoholism     141488775   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141488775    05418 Fluid shear stress and atherosclerosis     141488775  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlao01009]     141488775   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141488775    03036 Chromosome and associated proteins [BR:mlao03036]     141488775   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141488775 Protein phosphatases and associated proteins [BR:mlao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      141488775 Membrane trafficking [BR:mlao04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     141488775 Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      141488775 Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    141488775 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 Allatotropin-like_C SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C EF-hand_EFHB_C UPF0154 SAPC2_N EF-hand_11 BamM_C EFhand_Ca_insen TerB DUF5580_M EF-hand_STIM1 SPEF2_C GIP1_N SurA_N_3 Phage_TAC_12 MecA_N DUF2267 Motif Other DBs NCBI-GeneID:  141488775 NCBI-ProteinID:  XP_074045240 LinkDB All DBs Position 5:complement(241381415..241382078) Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFALFDKDGDGSITTKELGTIMRSLGQNPTEAELQDMINEVDADG NGTIDFSEFLTMMARKMKDTDSDEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDE EVDEMIREADMDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggaacaactgactgaggaacagattgcagaattcaaagaagcctttgcattattt gacaaggatggagatggtagtataacaacaaaggaactgggaactataatgagatcactt ggacagaaccccacagaagctgaattacaggacatgattaacgaagttgatgctgatggt aatggcacaattgacttttcagaatttctgactatgatggcaagaaaaatgaaggacaca gacagtgatgaagaaattcgagaagccttccgtgtgtttgacaaggatggtgatggtttt attagtgcagcagaacttcgtcatgtgatgacaaatcttggagagaagttaacagatgaa gaagttgatgaaatgatcagggaagccgatatggatggtgatggccaagtaaactatgaa gaatttgttcaaatgatgacagcaaaatga

DBGET integrated database retrieval system