Macrotis lagotis (bilby): 141490116 Help Entry 141490116         CDS       T11097                                  Name (RefSeq) C-C motif chemokine 4-like   KO K12964   C-C motif chemokine 4 Organism mlao  Macrotis lagotis (bilby) Pathway mlao04060   Cytokine-cytokine receptor interaction mlao04061   Viral protein interaction with cytokine and cytokine receptor mlao04062   Chemokine signaling pathway mlao04064   NF-kappa B signaling pathway mlao04620   Toll-like receptor signaling pathway mlao04623   Cytosolic DNA-sensing pathway mlao05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     141490116   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     141490116    04061 Viral protein interaction with cytokine and cytokine receptor     141490116  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     141490116    04623 Cytosolic DNA-sensing pathway     141490116    04062 Chemokine signaling pathway     141490116  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     141490116  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlao04052]     141490116 Cytokines and neuropeptides [BR:mlao04052]  Cytokines   Chemokines    141490116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  141490116 NCBI-ProteinID:  XP_074046477 LinkDB All DBs Position 5:complement(232064590..232066178) Genome browser AA seq 91 aa AA seqDB search MKVSVVALSILMVMAFNSLASSIPMGSNYPTSCCFSYVSRQIPRKFVTDYYETSSLCSQP AVVFQTKKGQEICTSPSDAWVQNYVEDLELN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagtttctgtggttgccctctccatcctcatggtcatggctttcaactctctggca tcttcgataccaatgggttccaactatcctacctcctgctgcttttcctatgtcagtcga cagatcccaagaaaatttgtgacagattattatgagaccagcagcctgtgttcccagcca gctgtggtgttccagaccaaaaaaggccaagaaatttgtaccagtcccagtgatgcctgg gttcagaactatgtagaagaccttgagctgaactga

DBGET integrated database retrieval system