Macrotis lagotis (bilby): 141490800 Help Entry 141490800         CDS       T11097                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mlao  Macrotis lagotis (bilby) Pathway mlao04015   Rap1 signaling pathway mlao04810   Regulation of actin cytoskeleton mlao05014   Amyotrophic lateral sclerosis mlao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     141490800 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     141490800 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141490800 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     141490800 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141490800 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlao04812]     141490800 (PFN2)    04147 Exosome [BR:mlao04147]     141490800 (PFN2) Membrane trafficking [BR:mlao04131]  Others   Actin-binding proteins    Others     141490800 (PFN2) Cytoskeleton proteins [BR:mlao04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      141490800 (PFN2) Exosome [BR:mlao04147]  Exosomal proteins   Proteins found in most exosomes    141490800 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  141490800 NCBI-ProteinID:  XP_074047187 LinkDB All DBs Position 6:46191922..46198128 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAFELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccatcgtgggctactgcgacgccaagtacgtgtgggcggccaccgccgggggcatcttc cagagcatcacgccgatcgagatcgacatgatcgtgggcaaggaccgggagggcttcttc accaacgggctgaccctcggggcaaagaagtgctcggtgatcagagacagcctgtacgtg gacggcgactgcacgatggacatcaggacaaagagtcaggggggagagcccacgtacaac gttgctgtgggcagagctggccgagcattggttatagtcatgggaaaggaaggtgtccat ggagggacactgaacaagaaagcatttgaactggctttatacctgaggaggtctgacgtc taa

DBGET integrated database retrieval system