KEGG   Macrotis lagotis (bilby): 141493218
Entry
141493218         CDS       T11097                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mlao  Macrotis lagotis (bilby)
Pathway
mlao01521  EGFR tyrosine kinase inhibitor resistance
mlao01522  Endocrine resistance
mlao04010  MAPK signaling pathway
mlao04012  ErbB signaling pathway
mlao04014  Ras signaling pathway
mlao04015  Rap1 signaling pathway
mlao04062  Chemokine signaling pathway
mlao04068  FoxO signaling pathway
mlao04071  Sphingolipid signaling pathway
mlao04072  Phospholipase D signaling pathway
mlao04137  Mitophagy - animal
mlao04140  Autophagy - animal
mlao04150  mTOR signaling pathway
mlao04151  PI3K-Akt signaling pathway
mlao04210  Apoptosis
mlao04211  Longevity regulating pathway
mlao04213  Longevity regulating pathway - multiple species
mlao04218  Cellular senescence
mlao04360  Axon guidance
mlao04370  VEGF signaling pathway
mlao04371  Apelin signaling pathway
mlao04540  Gap junction
mlao04550  Signaling pathways regulating pluripotency of stem cells
mlao04625  C-type lectin receptor signaling pathway
mlao04650  Natural killer cell mediated cytotoxicity
mlao04660  T cell receptor signaling pathway
mlao04662  B cell receptor signaling pathway
mlao04664  Fc epsilon RI signaling pathway
mlao04714  Thermogenesis
mlao04720  Long-term potentiation
mlao04722  Neurotrophin signaling pathway
mlao04725  Cholinergic synapse
mlao04726  Serotonergic synapse
mlao04730  Long-term depression
mlao04810  Regulation of actin cytoskeleton
mlao04910  Insulin signaling pathway
mlao04912  GnRH signaling pathway
mlao04914  Progesterone-mediated oocyte maturation
mlao04915  Estrogen signaling pathway
mlao04916  Melanogenesis
mlao04917  Prolactin signaling pathway
mlao04919  Thyroid hormone signaling pathway
mlao04921  Oxytocin signaling pathway
mlao04926  Relaxin signaling pathway
mlao04929  GnRH secretion
mlao04933  AGE-RAGE signaling pathway in diabetic complications
mlao04935  Growth hormone synthesis, secretion and action
mlao04960  Aldosterone-regulated sodium reabsorption
mlao05010  Alzheimer disease
mlao05022  Pathways of neurodegeneration - multiple diseases
mlao05034  Alcoholism
mlao05160  Hepatitis C
mlao05161  Hepatitis B
mlao05163  Human cytomegalovirus infection
mlao05165  Human papillomavirus infection
mlao05166  Human T-cell leukemia virus 1 infection
mlao05167  Kaposi sarcoma-associated herpesvirus infection
mlao05170  Human immunodeficiency virus 1 infection
mlao05200  Pathways in cancer
mlao05203  Viral carcinogenesis
mlao05205  Proteoglycans in cancer
mlao05206  MicroRNAs in cancer
mlao05207  Chemical carcinogenesis - receptor activation
mlao05208  Chemical carcinogenesis - reactive oxygen species
mlao05210  Colorectal cancer
mlao05211  Renal cell carcinoma
mlao05212  Pancreatic cancer
mlao05213  Endometrial cancer
mlao05214  Glioma
mlao05215  Prostate cancer
mlao05216  Thyroid cancer
mlao05218  Melanoma
mlao05219  Bladder cancer
mlao05220  Chronic myeloid leukemia
mlao05221  Acute myeloid leukemia
mlao05223  Non-small cell lung cancer
mlao05224  Breast cancer
mlao05225  Hepatocellular carcinoma
mlao05226  Gastric cancer
mlao05230  Central carbon metabolism in cancer
mlao05231  Choline metabolism in cancer
mlao05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mlao05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    141493218 (KRAS)
   04012 ErbB signaling pathway
    141493218 (KRAS)
   04014 Ras signaling pathway
    141493218 (KRAS)
   04015 Rap1 signaling pathway
    141493218 (KRAS)
   04370 VEGF signaling pathway
    141493218 (KRAS)
   04371 Apelin signaling pathway
    141493218 (KRAS)
   04068 FoxO signaling pathway
    141493218 (KRAS)
   04072 Phospholipase D signaling pathway
    141493218 (KRAS)
   04071 Sphingolipid signaling pathway
    141493218 (KRAS)
   04151 PI3K-Akt signaling pathway
    141493218 (KRAS)
   04150 mTOR signaling pathway
    141493218 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    141493218 (KRAS)
   04137 Mitophagy - animal
    141493218 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    141493218 (KRAS)
   04218 Cellular senescence
    141493218 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    141493218 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    141493218 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    141493218 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    141493218 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    141493218 (KRAS)
   04660 T cell receptor signaling pathway
    141493218 (KRAS)
   04662 B cell receptor signaling pathway
    141493218 (KRAS)
   04664 Fc epsilon RI signaling pathway
    141493218 (KRAS)
   04062 Chemokine signaling pathway
    141493218 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    141493218 (KRAS)
   04929 GnRH secretion
    141493218 (KRAS)
   04912 GnRH signaling pathway
    141493218 (KRAS)
   04915 Estrogen signaling pathway
    141493218 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    141493218 (KRAS)
   04917 Prolactin signaling pathway
    141493218 (KRAS)
   04921 Oxytocin signaling pathway
    141493218 (KRAS)
   04926 Relaxin signaling pathway
    141493218 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    141493218 (KRAS)
   04919 Thyroid hormone signaling pathway
    141493218 (KRAS)
   04916 Melanogenesis
    141493218 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    141493218 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    141493218 (KRAS)
   04726 Serotonergic synapse
    141493218 (KRAS)
   04720 Long-term potentiation
    141493218 (KRAS)
   04730 Long-term depression
    141493218 (KRAS)
   04722 Neurotrophin signaling pathway
    141493218 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    141493218 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    141493218 (KRAS)
   04213 Longevity regulating pathway - multiple species
    141493218 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    141493218 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    141493218 (KRAS)
   05206 MicroRNAs in cancer
    141493218 (KRAS)
   05205 Proteoglycans in cancer
    141493218 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    141493218 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    141493218 (KRAS)
   05203 Viral carcinogenesis
    141493218 (KRAS)
   05230 Central carbon metabolism in cancer
    141493218 (KRAS)
   05231 Choline metabolism in cancer
    141493218 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    141493218 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    141493218 (KRAS)
   05212 Pancreatic cancer
    141493218 (KRAS)
   05225 Hepatocellular carcinoma
    141493218 (KRAS)
   05226 Gastric cancer
    141493218 (KRAS)
   05214 Glioma
    141493218 (KRAS)
   05216 Thyroid cancer
    141493218 (KRAS)
   05221 Acute myeloid leukemia
    141493218 (KRAS)
   05220 Chronic myeloid leukemia
    141493218 (KRAS)
   05218 Melanoma
    141493218 (KRAS)
   05211 Renal cell carcinoma
    141493218 (KRAS)
   05219 Bladder cancer
    141493218 (KRAS)
   05215 Prostate cancer
    141493218 (KRAS)
   05213 Endometrial cancer
    141493218 (KRAS)
   05224 Breast cancer
    141493218 (KRAS)
   05223 Non-small cell lung cancer
    141493218 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    141493218 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    141493218 (KRAS)
   05161 Hepatitis B
    141493218 (KRAS)
   05160 Hepatitis C
    141493218 (KRAS)
   05163 Human cytomegalovirus infection
    141493218 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    141493218 (KRAS)
   05165 Human papillomavirus infection
    141493218 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    141493218 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    141493218 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    141493218 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    141493218 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    141493218 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    141493218 (KRAS)
   01522 Endocrine resistance
    141493218 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlao04131]
    141493218 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mlao04031]
    141493218 (KRAS)
Membrane trafficking [BR:mlao04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    141493218 (KRAS)
GTP-binding proteins [BR:mlao04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    141493218 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 141493218
NCBI-ProteinID: XP_074050334
LinkDB
Position
7:186116288..186157850
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKITKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtagatgagtatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagagacctgtctcttggatattctcgacacagcaggt
caagaggaatacagtgcaatgagggaccaatacatgaggactggggagggctttctatgt
gtatttgccataaataatactaaatcgtttgaagatattcaccattatagagaacaaata
aaaagagttaaagattctgaagatgtacccatggtccttgtaggaaataaatgtgattta
ccttccagaacagtagatacaaaacaagctcaggatttagcaagaagttatggaattcct
ttcattgaaacatcagcaaaaacaagacagagagtggaggatgctttttatacattggtg
agagagattcgacaatacagattgaaaaaaatcaccaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system