Macrotis lagotis (bilby): 141493373 Help Entry 141493373         CDS       T11097                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mlao  Macrotis lagotis (bilby) Pathway mlao04015   Rap1 signaling pathway mlao04810   Regulation of actin cytoskeleton mlao05014   Amyotrophic lateral sclerosis mlao05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     141493373 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     141493373 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141493373 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     141493373 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141493373 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlao04812]     141493373 (PFN4)    04147 Exosome [BR:mlao04147]     141493373 (PFN4) Membrane trafficking [BR:mlao04131]  Others   Actin-binding proteins    Others     141493373 (PFN4) Cytoskeleton proteins [BR:mlao04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      141493373 (PFN4) Exosome [BR:mlao04147]  Exosomal proteins   Proteins found in most exosomes    141493373 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  141493373 NCBI-ProteinID:  XP_074050717 LinkDB All DBs Position 1:507277..545548 Genome browser AA seq 129 aa AA seqDB search MSNVQNLLLESLLGTKHVDCAAIIKLHKRTVLVSSPGFNLTPNDIRVLVNGFSKNPLQVR REGFYFKEKYYTCVRADERSLYAKKNNTGLVVVQTHLYLLVATYREDMYASVCVEAVEKL GDYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagcaatgtgcagaacctgctgctagaatccctcctagggacaaaacatgtggactgt gctgccatcatcaagcttcacaagcggactgtcttggtgtcctcaccagggtttaattta acacccaatgacatccgtgtgcttgtgaatggattctccaagaaccctcttcaagttcga agggaaggattctacttcaaggagaagtattacacgtgtgtcagagcagatgagcgctcc ctttatgccaagaagaacaacacaggactggtggtcgttcaaacccatctctacctgctg gtggccacatatagagaggacatgtatgccagtgtgtgtgtggaggctgtggagaagctg ggtgactacttaaggaaaaagggaaattaa

DBGET integrated database retrieval system