Macrotis lagotis (bilby): 141495984 Help Entry 141495984         CDS       T11097                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mlao  Macrotis lagotis (bilby) Pathway mlao04014   Ras signaling pathway mlao04015   Rap1 signaling pathway mlao04022   cGMP-PKG signaling pathway mlao04024   cAMP signaling pathway mlao04062   Chemokine signaling pathway mlao04071   Sphingolipid signaling pathway mlao04072   Phospholipase D signaling pathway mlao04081   Hormone signaling mlao04144   Endocytosis mlao04150   mTOR signaling pathway mlao04270   Vascular smooth muscle contraction mlao04310   Wnt signaling pathway mlao04350   TGF-beta signaling pathway mlao04360   Axon guidance mlao04510   Focal adhesion mlao04517   IgSF CAM signaling mlao04519   Cadherin signaling mlao04520   Adherens junction mlao04530   Tight junction mlao04611   Platelet activation mlao04621   NOD-like receptor signaling pathway mlao04625   C-type lectin receptor signaling pathway mlao04660   T cell receptor signaling pathway mlao04670   Leukocyte transendothelial migration mlao04722   Neurotrophin signaling pathway mlao04810   Regulation of actin cytoskeleton mlao04921   Oxytocin signaling pathway mlao04928   Parathyroid hormone synthesis, secretion and action mlao04972   Pancreatic secretion mlao05100   Bacterial invasion of epithelial cells mlao05132   Salmonella infection mlao05133   Pertussis mlao05135   Yersinia infection mlao05152   Tuberculosis mlao05163   Human cytomegalovirus infection mlao05200   Pathways in cancer mlao05203   Viral carcinogenesis mlao05205   Proteoglycans in cancer mlao05206   MicroRNAs in cancer mlao05210   Colorectal cancer mlao05417   Lipid and atherosclerosis mlao05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     141495984 (RHOA)    04015 Rap1 signaling pathway     141495984 (RHOA)    04310 Wnt signaling pathway     141495984 (RHOA)    04350 TGF-beta signaling pathway     141495984 (RHOA)    04072 Phospholipase D signaling pathway     141495984 (RHOA)    04071 Sphingolipid signaling pathway     141495984 (RHOA)    04024 cAMP signaling pathway     141495984 (RHOA)    04022 cGMP-PKG signaling pathway     141495984 (RHOA)    04150 mTOR signaling pathway     141495984 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     141495984 (RHOA)    04517 IgSF CAM signaling     141495984 (RHOA)    04519 Cadherin signaling     141495984 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141495984 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     141495984 (RHOA)    04520 Adherens junction     141495984 (RHOA)    04530 Tight junction     141495984 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     141495984 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     141495984 (RHOA)    04621 NOD-like receptor signaling pathway     141495984 (RHOA)    04625 C-type lectin receptor signaling pathway     141495984 (RHOA)    04660 T cell receptor signaling pathway     141495984 (RHOA)    04670 Leukocyte transendothelial migration     141495984 (RHOA)    04062 Chemokine signaling pathway     141495984 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     141495984 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     141495984 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     141495984 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     141495984 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     141495984 (RHOA)   09158 Development and regeneration    04360 Axon guidance     141495984 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141495984 (RHOA)    05206 MicroRNAs in cancer     141495984 (RHOA)    05205 Proteoglycans in cancer     141495984 (RHOA)    05203 Viral carcinogenesis     141495984 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     141495984 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     141495984 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     141495984 (RHOA)    05135 Yersinia infection     141495984 (RHOA)    05133 Pertussis     141495984 (RHOA)    05152 Tuberculosis     141495984 (RHOA)    05100 Bacterial invasion of epithelial cells     141495984 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141495984 (RHOA)    05418 Fluid shear stress and atherosclerosis     141495984 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141495984 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141495984 (RHOA)    04031 GTP-binding proteins [BR:mlao04031]     141495984 (RHOA) Membrane trafficking [BR:mlao04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     141495984 (RHOA) Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141495984 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    141495984 (RHOA)   Exosomal proteins of colorectal cancer cells    141495984 (RHOA)   Exosomal proteins of bladder cancer cells    141495984 (RHOA) GTP-binding proteins [BR:mlao04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     141495984 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  141495984 NCBI-ProteinID:  XP_074054043 LinkDB All DBs Position 8:complement(105347733..105414130) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggccgccatccgaaaaaagttggttatagttggtgatggtgcatgtgggaagacatgc ttgctgatcgtatttagcaaagaccaattccctgaagtttatgtgcccacagtgtttgaa aattatgtagcagatattgaagtggatggaaaacaggtggagttggctttgtgggacaca gctggtcaagaagattatgatcgccttagacctctttcctacccagatactgatgttata cttatgtgtttttccatcgatagccctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgtcccaacgtgcccattatcctggttgggaataagaaggat cttcgaaatgatgagcacacgagacgggaactggccaagatgaagcaggagccagtgaaa cctgaagaaggtagagatatggcaaatcggattggtgcatttggttatatggagtgttca gcaaagaccaaagacggtgtgagggaggtttttgaaatggccacaagagcggctttgcaa gccagacgtggaaagaagaaatccgggtgccttgtcttgtaa

DBGET integrated database retrieval system