Macrotis lagotis (bilby): 141496173 Help Entry 141496173         CDS       T11097                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mlao  Macrotis lagotis (bilby) Pathway mlao04137   Mitophagy - animal mlao04140   Autophagy - animal mlao04144   Endocytosis mlao04145   Phagosome mlao04148   Efferocytosis mlao05132   Salmonella infection mlao05146   Amoebiasis mlao05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mlao00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141496173 (RAB7A)    04145 Phagosome     141496173 (RAB7A)    04140 Autophagy - animal     141496173 (RAB7A)    04137 Mitophagy - animal     141496173 (RAB7A)    04148 Efferocytosis     141496173 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141496173 (RAB7A)    05152 Tuberculosis     141496173 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     141496173 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141496173 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141496173 (RAB7A)    04031 GTP-binding proteins [BR:mlao04031]     141496173 (RAB7A) Membrane trafficking [BR:mlao04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     141496173 (RAB7A) Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141496173 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    141496173 (RAB7A)   Exosomal proteins of colorectal cancer cells    141496173 (RAB7A)   Exosomal proteins of bladder cancer cells    141496173 (RAB7A) GTP-binding proteins [BR:mlao04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     141496173 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  141496173 NCBI-ProteinID:  XP_074054514 LinkDB All DBs Position 8:complement(133200665..133275241) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaagttatcatcctaggagattctggggtgggt aagacctcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagcaaca ataggagcagactttctgacaaaggaagtgatggtggatgacagactagtgacaatgcag atctgggacacagcagggcaagaacgatttcagtccctcggtgtggccttctatagagga gcagactgctgcgtcctggtctttgatgtgactgcccctaacacattcaaaactcttgat agctggagagatgaatttctcatccaagccagtcccagggatcctgaaaacttccccttt gttgtattgggaaacaagattgacctagaaaacagacaagttgccacaaaacgagcacag gcctggtgctacagcaaaaataacatcccgtactttgagaccagtgccaaggaagccatc aatgtggagcaggcgttccaaaccattgcacgaaatgcacttaaacaggagacagaggtg gagctgtacaacgaattccctgagcccatcaaactggacaagaacgaccgagcaaaggct tctgccgaaagctgcagctgctga

DBGET integrated database retrieval system