Macrotis lagotis (bilby): 141498448 Help Entry 141498448         CDS       T11097                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mlao  Macrotis lagotis (bilby) Pathway mlao01521   EGFR tyrosine kinase inhibitor resistance mlao01524   Platinum drug resistance mlao04014   Ras signaling pathway mlao04064   NF-kappa B signaling pathway mlao04115   p53 signaling pathway mlao04137   Mitophagy - animal mlao04140   Autophagy - animal mlao04151   PI3K-Akt signaling pathway mlao04210   Apoptosis mlao04215   Apoptosis - multiple species mlao04621   NOD-like receptor signaling pathway mlao04630   JAK-STAT signaling pathway mlao05012   Parkinson disease mlao05014   Amyotrophic lateral sclerosis mlao05022   Pathways of neurodegeneration - multiple diseases mlao05145   Toxoplasmosis mlao05162   Measles mlao05166   Human T-cell leukemia virus 1 infection mlao05168   Herpes simplex virus 1 infection mlao05170   Human immunodeficiency virus 1 infection mlao05200   Pathways in cancer mlao05202   Transcriptional misregulation in cancer mlao05212   Pancreatic cancer mlao05220   Chronic myeloid leukemia mlao05222   Small cell lung cancer mlao05225   Hepatocellular carcinoma mlao05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     141498448    04630 JAK-STAT signaling pathway     141498448    04064 NF-kappa B signaling pathway     141498448    04151 PI3K-Akt signaling pathway     141498448  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141498448    04137 Mitophagy - animal     141498448   09143 Cell growth and death    04210 Apoptosis     141498448    04215 Apoptosis - multiple species     141498448    04115 p53 signaling pathway     141498448  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     141498448  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141498448    05202 Transcriptional misregulation in cancer     141498448   09162 Cancer: specific types    05212 Pancreatic cancer     141498448    05225 Hepatocellular carcinoma     141498448    05220 Chronic myeloid leukemia     141498448    05222 Small cell lung cancer     141498448   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     141498448    05170 Human immunodeficiency virus 1 infection     141498448    05162 Measles     141498448    05168 Herpes simplex virus 1 infection     141498448   09174 Infectious disease: parasitic    05145 Toxoplasmosis     141498448   09164 Neurodegenerative disease    05012 Parkinson disease     141498448    05014 Amyotrophic lateral sclerosis     141498448    05022 Pathways of neurodegeneration - multiple diseases     141498448   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141498448   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     141498448    01524 Platinum drug resistance     141498448  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlao01009]     141498448   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141498448   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlao02000]     141498448 Protein phosphatases and associated proteins [BR:mlao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      141498448 Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     141498448 Transporters [BR:mlao02000]  Other transporters   Pores ion channels [TC:1]    141498448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  141498448 NCBI-ProteinID:  XP_074057743 LinkDB All DBs Position X:complement(10783859..10784700) Genome browser AA seq 205 aa AA seqDB search MSHSNRELVVDFLSYKLSQKGYNRSQFEDESRTEASEGTEIPTTVNGSPSWHPADSRVVS GATGHSSSLDAHETIPVAAVKQALREAGDEFELQYRRAFSDLTSQLHITPGTAYQSFEQV VNELFRDGVNWGRIVAFFSFGGALCMESVDKEMEVLVGRITSWMATYLDEHLDPWIQENG GWDTFVELYGNDAAAESRKGQERFN NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtctcacagcaaccgggagctggtggttgactttctttcttacaagctttcacagaaa ggatacaatcggagtcagtttgaagatgaaagcaggactgaggcctcagaagggacagag atacctactactgtgaatggcagcccctcttggcaccccgctgacagccgagtggtgagt ggggccacaggacacagcagcagcctggatgcccatgagacgatacccgtcgctgctgtg aagcaagctttgagggaggcaggagatgaatttgaactccaataccggcgggcattcagt gacctgacgtcccagctccacatcactccagggactgcttatcagagctttgagcaggta gtgaatgaactcttccgggatggggtgaactggggccgaattgtggcattcttctccttc ggaggggcgttgtgtatggaaagtgtggataaggagatggaagtcttggtaggacggatc acctcctggatggccacttacttggatgaacacctagatccctggatccaagaaaatggt ggttgggacaccttcgtggagctctatgggaatgatgcagctgcagagagccggaagggc caggaacgcttcaactga

DBGET integrated database retrieval system