Macrotis lagotis (bilby): 141499931 Help Entry 141499931         CDS       T11097                                  Name (RefSeq) interferon alpha-16-like   KO K05414   interferon alpha Organism mlao  Macrotis lagotis (bilby) Pathway mlao04060   Cytokine-cytokine receptor interaction mlao04151   PI3K-Akt signaling pathway mlao04217   Necroptosis mlao04620   Toll-like receptor signaling pathway mlao04621   NOD-like receptor signaling pathway mlao04622   RIG-I-like receptor signaling pathway mlao04623   Cytosolic DNA-sensing pathway mlao04630   JAK-STAT signaling pathway mlao04650   Natural killer cell mediated cytotoxicity mlao04936   Alcoholic liver disease mlao05152   Tuberculosis mlao05160   Hepatitis C mlao05161   Hepatitis B mlao05162   Measles mlao05163   Human cytomegalovirus infection mlao05164   Influenza A mlao05165   Human papillomavirus infection mlao05167   Kaposi sarcoma-associated herpesvirus infection mlao05168   Herpes simplex virus 1 infection mlao05169   Epstein-Barr virus infection mlao05170   Human immunodeficiency virus 1 infection mlao05171   Coronavirus disease - COVID-19 mlao05200   Pathways in cancer mlao05320   Autoimmune thyroid disease mlao05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     141499931    04151 PI3K-Akt signaling pathway     141499931   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     141499931  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     141499931  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     141499931    04621 NOD-like receptor signaling pathway     141499931    04622 RIG-I-like receptor signaling pathway     141499931    04623 Cytosolic DNA-sensing pathway     141499931    04650 Natural killer cell mediated cytotoxicity     141499931  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141499931   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     141499931    05161 Hepatitis B     141499931    05160 Hepatitis C     141499931    05171 Coronavirus disease - COVID-19     141499931    05164 Influenza A     141499931    05162 Measles     141499931    05168 Herpes simplex virus 1 infection     141499931    05163 Human cytomegalovirus infection     141499931    05167 Kaposi sarcoma-associated herpesvirus infection     141499931    05169 Epstein-Barr virus infection     141499931    05165 Human papillomavirus infection     141499931   09171 Infectious disease: bacterial    05152 Tuberculosis     141499931   09163 Immune disease    05320 Autoimmune thyroid disease     141499931   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141499931   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     141499931  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlao04052]     141499931 Cytokines and neuropeptides [BR:mlao04052]  Cytokines   Interferons    141499931 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Carbam_trans_N Motif Other DBs NCBI-GeneID:  141499931 NCBI-ProteinID:  XP_074058827 LinkDB All DBs Position X:complement(193285347..193285898) Genome browser AA seq 183 aa AA seqDB search MTSWTLFPFALVLLCSSSLCSLGCDLTQGLQEDFSLLNQMSTFPLVPCWKDWTRFNFPKE AMEGSQLQRRNATVIVHEMLQQIFTIFSMNAGPDAWNQTQLMQLFIGLDQQLQQLEKCIG QDREWEEPFLENENLRLALRSYFQGLSQYLQGREYSYCAWEIVRVEIRRVFLFMSKLTRK FRN NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgacctcctggaccttatttccatttgccctggtgctgctctgctccagctctctctgc tctctgggttgtgacctgactcaaggactgcaggaagacttctcacttctgaatcaaatg agcacatttcccctggtaccatgttggaaggactggaccagatttaacttcccaaaggaa gccatggaaggcagccaactccagaggaggaatgccacagtcattgttcatgagatgctc cagcagatcttcaccatcttcagtatgaatgctggtcctgatgcttggaatcaaactcag ctcatgcaactgttcattggactggatcagcagctgcagcagctggagaagtgtattggg caagatagggaatgggaagagcctttcttggagaatgagaacctcaggttggccttgagg agctatttccaaggactaagccaatacctgcaaggaagagagtatagttattgtgcctgg gagattgtacgagtagagatcaggagggtcttcctgttcatgagtaaactaacaagaaaa ttcagaaactga

DBGET integrated database retrieval system