Macrotis lagotis (bilby): 141502461
Help
Entry
141502461 CDS
T11097
Symbol
NDUFB6
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
KO
K03962
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
mlao Macrotis lagotis (bilby)
Pathway
mlao00190
Oxidative phosphorylation
mlao01100
Metabolic pathways
mlao04714
Thermogenesis
mlao04723
Retrograde endocannabinoid signaling
mlao04932
Non-alcoholic fatty liver disease
mlao05010
Alzheimer disease
mlao05012
Parkinson disease
mlao05014
Amyotrophic lateral sclerosis
mlao05016
Huntington disease
mlao05020
Prion disease
mlao05022
Pathways of neurodegeneration - multiple diseases
mlao05208
Chemical carcinogenesis - reactive oxygen species
mlao05415
Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:
mlao00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
141502461 (NDUFB6)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
141502461 (NDUFB6)
09159 Environmental adaptation
04714 Thermogenesis
141502461 (NDUFB6)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
141502461 (NDUFB6)
09164 Neurodegenerative disease
05010 Alzheimer disease
141502461 (NDUFB6)
05012 Parkinson disease
141502461 (NDUFB6)
05014 Amyotrophic lateral sclerosis
141502461 (NDUFB6)
05016 Huntington disease
141502461 (NDUFB6)
05020 Prion disease
141502461 (NDUFB6)
05022 Pathways of neurodegeneration - multiple diseases
141502461 (NDUFB6)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
141502461 (NDUFB6)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
141502461 (NDUFB6)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NDUF_B6
Motif
Other DBs
NCBI-GeneID:
141502461
NCBI-ProteinID:
XP_074063319
LinkDB
All DBs
Position
X:98327170..98340858
Genome browser
AA seq
127 aa
AA seq
DB search
MSGFTPDEKLRLEQLRTLRRQWLKDQELSPREPVLPQQKAWFGFSDNFLQTSSIWKRFAF
KTLRNGMFLFTNLILPAWIVHYYVKYHVQTKPYGIVEKKPKIFPGDKILETGEVVPPMKV
CDIHDYH
NT seq
384 nt
NT seq
+upstream
nt +downstream
nt
atgtcggggttcacgcccgacgagaagctgcggctggagcagctgcgcaccctgcggagg
cagtggctgaaggaccaggagctgagcccccgggagcccgtgctgccccagcagaaggcc
tggtttggcttctcggataacttcctgcagaccagctccatctggaagagatttgctttt
aagacactccgaaatggaatgttcctttttaccaatttaattttaccagcctggattgtt
cactattatgtcaaataccatgttcaaacaaaaccatatggcatcgttgaaaagaaaccc
aaaatatttccaggtgataaaattctggagactggagaagtggttccaccaatgaaagtc
tgtgatatacatgattatcattaa
DBGET
integrated database retrieval system