Macrotis lagotis (bilby): 141505734 Help Entry 141505734         CDS       T11097                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mlao  Macrotis lagotis (bilby) Pathway mlao01521   EGFR tyrosine kinase inhibitor resistance mlao01524   Platinum drug resistance mlao04014   Ras signaling pathway mlao04064   NF-kappa B signaling pathway mlao04115   p53 signaling pathway mlao04137   Mitophagy - animal mlao04140   Autophagy - animal mlao04151   PI3K-Akt signaling pathway mlao04210   Apoptosis mlao04215   Apoptosis - multiple species mlao04621   NOD-like receptor signaling pathway mlao04630   JAK-STAT signaling pathway mlao05012   Parkinson disease mlao05014   Amyotrophic lateral sclerosis mlao05022   Pathways of neurodegeneration - multiple diseases mlao05145   Toxoplasmosis mlao05162   Measles mlao05166   Human T-cell leukemia virus 1 infection mlao05168   Herpes simplex virus 1 infection mlao05170   Human immunodeficiency virus 1 infection mlao05200   Pathways in cancer mlao05202   Transcriptional misregulation in cancer mlao05212   Pancreatic cancer mlao05220   Chronic myeloid leukemia mlao05222   Small cell lung cancer mlao05225   Hepatocellular carcinoma mlao05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     141505734 (BCL2L1)    04630 JAK-STAT signaling pathway     141505734 (BCL2L1)    04064 NF-kappa B signaling pathway     141505734 (BCL2L1)    04151 PI3K-Akt signaling pathway     141505734 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141505734 (BCL2L1)    04137 Mitophagy - animal     141505734 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     141505734 (BCL2L1)    04215 Apoptosis - multiple species     141505734 (BCL2L1)    04115 p53 signaling pathway     141505734 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     141505734 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     141505734 (BCL2L1)    05202 Transcriptional misregulation in cancer     141505734 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     141505734 (BCL2L1)    05225 Hepatocellular carcinoma     141505734 (BCL2L1)    05220 Chronic myeloid leukemia     141505734 (BCL2L1)    05222 Small cell lung cancer     141505734 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     141505734 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     141505734 (BCL2L1)    05162 Measles     141505734 (BCL2L1)    05168 Herpes simplex virus 1 infection     141505734 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     141505734 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     141505734 (BCL2L1)    05014 Amyotrophic lateral sclerosis     141505734 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     141505734 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     141505734 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     141505734 (BCL2L1)    01524 Platinum drug resistance     141505734 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlao01009]     141505734 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141505734 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlao02000]     141505734 (BCL2L1) Protein phosphatases and associated proteins [BR:mlao01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      141505734 (BCL2L1) Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     141505734 (BCL2L1) Transporters [BR:mlao02000]  Other transporters   Pores ion channels [TC:1]    141505734 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  141505734 NCBI-ProteinID:  XP_074067938 LinkDB All DBs Position 1:complement(343755234..343800280) Genome browser AA seq 227 aa AA seqDB search MSHSNRELVVDFLSYKLSQKGYNWSQFEDESRTEASEGTEIPTTVNGSPSWHPADSRAVS GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRITSWMATYLDEHLDPWIQENG GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgtctcacagcaaccgggagctggtggttgactttctttcttacaagctttcacagaaa ggatacaattggagtcagtttgaagatgaaagcaggactgaggcctcagaagggacagag atacctactactgtgaatggcagcccctcttggcaccctgctgacagccgagcggtgagt ggggccacaggacacagcagcagcctggatgcccatgagacgatacccgtcgctgctgtg aagcaagctttgagggaggcgggagatgaatttgaactccgataccggcgggcattcagt gacctgacgtcccagctccacatcactccagggactgcttatcagagcttcgagcaggta gtgaatgaactcttccgggatggggtgaactggggccgaattgtggcattcttctccttc ggaggggccttgtgtgtggaaagcgtggataaggagatggaagtcttggtaggacgcatc acctcctggatggccacttacttggatgaacacctagatccttggatccaagaaaatggc ggttgggacaccttcgtggagctctatgggaatgatgcagctgcagagagccggaagggc caggaacgcttcaaccgatggctgctgactggcatgacagtggctggtgtagtcctgttg ggatccctcttcagccggaagtga

DBGET integrated database retrieval system