Macrotis lagotis (bilby): 141506763 Help Entry 141506763         CDS       T11097                                  Name (RefSeq) histone H3.3C-like   KO K11253   histone H3 Organism mlao  Macrotis lagotis (bilby) Pathway mlao04613   Neutrophil extracellular trap formation mlao05034   Alcoholism mlao05202   Transcriptional misregulation in cancer mlao05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlao00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     141506763  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     141506763   09163 Immune disease    05322 Systemic lupus erythematosus     141506763   09165 Substance dependence    05034 Alcoholism     141506763  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141506763   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141506763 Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141506763 Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141506763 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-T_C Motif Other DBs NCBI-GeneID:  141506763 NCBI-ProteinID:  XP_074069937 LinkDB All DBs Position 1:764341782..764343183 Genome browser AA seq 145 aa AA seqDB search MKHFFNSRNVACTKQTAHKSTGGKAPRKQLATKAVRKSAPSTRGVKKPHRYRPGTVALRE IRRYQKSIKLLIRKLPFQHLVREIAQDFKTDLCFQSAAIGAFQEASEAYLVGLFEDTNLC AIHAKCVTIMPKDIQLARRIRGECA NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgaagcacttcttcaactcaaggaatgtggcttgtaccaagcaaactgcccataaatcc accggtggcaaagcccccaggaagcagctcgccacaaaagctgttcgcaagagtgcgccc tctaccagaggggtcaagaagcctcaccgctacaggccaggtactgtggctctccgtgaa atcagacgttatcagaagtccatcaaacttctgattcgtaaactccccttccagcatctg gtgcgtgaaattgctcaggacttcaaaacagatctgtgcttccagagtgcagcaattggt gcttttcaggaggcaagtgaagcttatctggttggcctgtttgaggacaccaacctatgt gctatccacgccaaatgtgtcacaatcatgccaaaagatatccagctagcacgccgcata cgtggagaatgtgcttaa

DBGET integrated database retrieval system