Macrotis lagotis (bilby): 141514653 Help Entry 141514653         CDS       T11097                                  Name (RefSeq) histone H2A type 1-J   KO K11251   histone H2A Organism mlao  Macrotis lagotis (bilby) Pathway mlao03082   ATP-dependent chromatin remodeling mlao04217   Necroptosis mlao04613   Neutrophil extracellular trap formation mlao05034   Alcoholism mlao05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlao00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     141514653  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     141514653  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     141514653  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     141514653   09165 Substance dependence    05034 Alcoholism     141514653  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141514653   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141514653 Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141514653 Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141514653 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  141514653 NCBI-ProteinID:  XP_074081731 LinkDB All DBs Position 2:complement(245994930..245999050) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKTKSK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaagcaaggagggaaggctcgcgccaaagcgaagtcaagatcttct cgagcgggcctgcagtttccagtaggtcgtgttcatcgcctgctgcgaaagggcaattat gccgaaagggttggggccggagctccggtttatttggctgcggtcttggaatatttgacc gccgaaatcttagaacttgcgggaaacgcggcccgggacaacaagaagacccgtattatt ccccgccatctacagctggccatccgtaacgatgaagagctcaacaagttgttgggcaaa gtgaccattgctcagggtggcgtcctgcccaacatccaggctgtacttctgccaaagaaa acggagagccatcataagaccaagagcaagtaa

DBGET integrated database retrieval system