Macrotis lagotis (bilby): 141514662 Help Entry 141514662         CDS       T11097                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism mlao  Macrotis lagotis (bilby) Pathway mlao04613   Neutrophil extracellular trap formation mlao05034   Alcoholism mlao05203   Viral carcinogenesis mlao05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlao00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     141514662  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     141514662   09163 Immune disease    05322 Systemic lupus erythematosus     141514662   09165 Substance dependence    05034 Alcoholism     141514662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141514662   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141514662 Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141514662 Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141514662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  141514662 NCBI-ProteinID:  XP_074081741 LinkDB All DBs Position 2:complement(246085371..246086934) Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcccgccaaatccgctcccgccccaaagaagggctccaagaaggctgtgacc aaggcgcagaagaaagatggcaagaagcgtaagcgcagtcgcaaggaaagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacacgggcatctcctccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc ctggcgcactacaacaagcgctccaccatcacttcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtag

DBGET integrated database retrieval system