Macrotis lagotis (bilby): 141516584 Help Entry 141516584         CDS       T11097                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mlao  Macrotis lagotis (bilby) Pathway mlao04010   MAPK signaling pathway mlao04014   Ras signaling pathway mlao04015   Rap1 signaling pathway mlao04022   cGMP-PKG signaling pathway mlao04066   HIF-1 signaling pathway mlao04068   FoxO signaling pathway mlao04072   Phospholipase D signaling pathway mlao04081   Hormone signaling mlao04114   Oocyte meiosis mlao04140   Autophagy - animal mlao04150   mTOR signaling pathway mlao04151   PI3K-Akt signaling pathway mlao04152   AMPK signaling pathway mlao04211   Longevity regulating pathway mlao04213   Longevity regulating pathway - multiple species mlao04810   Regulation of actin cytoskeleton mlao04910   Insulin signaling pathway mlao04911   Insulin secretion mlao04913   Ovarian steroidogenesis mlao04914   Progesterone-mediated oocyte maturation mlao04917   Prolactin signaling pathway mlao04923   Regulation of lipolysis in adipocytes mlao04930   Type II diabetes mellitus mlao04931   Insulin resistance mlao04932   Non-alcoholic fatty liver disease mlao04940   Type I diabetes mellitus mlao04950   Maturity onset diabetes of the young mlao04960   Aldosterone-regulated sodium reabsorption mlao05010   Alzheimer disease mlao05215   Prostate cancer mlao05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141516584 (INS)    04014 Ras signaling pathway     141516584 (INS)    04015 Rap1 signaling pathway     141516584 (INS)    04066 HIF-1 signaling pathway     141516584 (INS)    04068 FoxO signaling pathway     141516584 (INS)    04072 Phospholipase D signaling pathway     141516584 (INS)    04022 cGMP-PKG signaling pathway     141516584 (INS)    04151 PI3K-Akt signaling pathway     141516584 (INS)    04152 AMPK signaling pathway     141516584 (INS)    04150 mTOR signaling pathway     141516584 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     141516584 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141516584 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     141516584 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     141516584 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     141516584 (INS)    04910 Insulin signaling pathway     141516584 (INS)    04923 Regulation of lipolysis in adipocytes     141516584 (INS)    04913 Ovarian steroidogenesis     141516584 (INS)    04914 Progesterone-mediated oocyte maturation     141516584 (INS)    04917 Prolactin signaling pathway     141516584 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     141516584 (INS)   09149 Aging    04211 Longevity regulating pathway     141516584 (INS)    04213 Longevity regulating pathway - multiple species     141516584 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     141516584 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     141516584 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     141516584 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     141516584 (INS)    04940 Type I diabetes mellitus     141516584 (INS)    04950 Maturity onset diabetes of the young     141516584 (INS)    04932 Non-alcoholic fatty liver disease     141516584 (INS)    04931 Insulin resistance     141516584 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlao04052]     141516584 (INS) Cytokines and neuropeptides [BR:mlao04052]  Neuropeptides   Unclassified    141516584 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  141516584 NCBI-ProteinID:  XP_074083702 LinkDB All DBs Position 3:complement(275633930..275634796) Genome browser AA seq 103 aa AA seqDB search MASWMAPLSLLALLALTAPPAGEAAVNQHLCGSHLVEALYLVCGERGFFYTPKSRRAAEQ PLGDEAGGEELPFPPEYQLQKRGIVEQCCNSICSLYQLETYCN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcttcctggatggcccccctgtccctgctggccctactggccctgactgccccccca gcgggtgaagctgccgtcaaccaacacctgtgtggctcccacctggtggaggccttgtac ctggtgtgtggggagagaggcttcttctatacccccaaatcgcgccgggctgctgagcag ccgctgggggatgaggccggaggggaagagctacccttcccccctgagtaccagctgcag aagcggggcatcgtcgagcagtgctgcaacagcatctgttccctctaccagctggagacc tactgcaactag

DBGET integrated database retrieval system