Macrotis lagotis (bilby): 141517268 Help Entry 141517268         CDS       T11097                                  Symbol H2AZ1 Name (RefSeq) histone H2A.Z isoform X1   KO K11251   histone H2A Organism mlao  Macrotis lagotis (bilby) Pathway mlao03082   ATP-dependent chromatin remodeling mlao04217   Necroptosis mlao04613   Neutrophil extracellular trap formation mlao05034   Alcoholism mlao05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlao00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     141517268 (H2AZ1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     141517268 (H2AZ1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     141517268 (H2AZ1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     141517268 (H2AZ1)   09165 Substance dependence    05034 Alcoholism     141517268 (H2AZ1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlao03036]     141517268 (H2AZ1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141517268 (H2AZ1) Chromosome and associated proteins [BR:mlao03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141517268 (H2AZ1) Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141517268 (H2AZ1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  141517268 NCBI-ProteinID:  XP_074084203 LinkDB All DBs Position 3:complement(9647683..9649388) Genome browser AA seq 134 aa AA seqDB search MGVCLLQAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY SAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHI HKSLIGKKGQQKTV NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgggcgtgtgcctcctgcaggccggcgggaaggcggggaaggactccggaaaggccaag acaaaggcggtttcccgctcgcagagggcgggcttgcagttcccagtgggccgcatccac cggcacctgaagtcgcggacgacgagccacgggcgcgtgggggccaccgccgccgtgtac agcgccgccatcctggagtacctgacggccgaggtgctggagctggcgggaaacgcgtcc aaagacttgaaggtgaagcgcatcaccccgcgccacctgcagctggccatccgcggcgac gaggagctggactcgctcatcaaggccaccatcgcgggcggcggcgtgatcccacacatc cacaaatctctgatcggaaagaaaggacagcagaagactgtttaa

DBGET integrated database retrieval system